BLASTX nr result
ID: Zingiber23_contig00010122
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00010122 (451 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003580712.1| PREDICTED: protein TIFY 3B-like [Brachypodiu... 55 7e-06 >ref|XP_003580712.1| PREDICTED: protein TIFY 3B-like [Brachypodium distachyon] Length = 195 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/48 (58%), Positives = 36/48 (75%), Gaps = 5/48 (10%) Frame = -3 Query: 395 PIARRHSLQRFLEKRRNRVVSNAPYASSKP-----LNTAEMASEAQTQ 267 PIARRHSLQRFLEKRR+R+VS APY+ +KP + E+A+E + Q Sbjct: 148 PIARRHSLQRFLEKRRDRIVSKAPYSPAKPSEGMGASGMEIAAEGKAQ 195