BLASTX nr result
ID: Zingiber23_contig00007522
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00007522 (365 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004490743.1| PREDICTED: CBS domain-containing protein CBS... 83 4e-14 ref|XP_004490742.1| PREDICTED: CBS domain-containing protein CBS... 83 4e-14 ref|XP_002526389.1| conserved hypothetical protein [Ricinus comm... 80 2e-13 ref|XP_006464969.1| PREDICTED: CBS domain-containing protein CBS... 80 3e-13 gb|EMJ08681.1| hypothetical protein PRUPE_ppa011584mg [Prunus pe... 80 3e-13 emb|CBI15781.3| unnamed protein product [Vitis vinifera] 80 3e-13 ref|XP_002319991.1| hypothetical protein POPTR_0013s15730g [Popu... 80 3e-13 ref|XP_002262902.1| PREDICTED: CBS domain-containing protein CBS... 80 3e-13 gb|ABK64186.1| CBS domain-containing protein [Solenostemon scute... 80 3e-13 ref|XP_003616097.1| Cbs domain protein [Medicago truncatula] gi|... 80 4e-13 ref|XP_003616096.1| Cbs domain protein [Medicago truncatula] gi|... 80 4e-13 ref|XP_003616095.1| Cbs domain protein [Medicago truncatula] gi|... 80 4e-13 ref|XP_006840268.1| hypothetical protein AMTR_s00045p00043360 [A... 79 5e-13 gb|EOX90565.1| Cystathionine beta-synthase (CBS) family protein ... 79 5e-13 gb|EOX90564.1| Cystathionine beta-synthase (CBS) family protein ... 79 5e-13 ref|XP_006289085.1| hypothetical protein CARUB_v10002490mg [Caps... 79 5e-13 ref|XP_004154564.1| PREDICTED: LOW QUALITY PROTEIN: CBS domain-c... 79 5e-13 ref|XP_004139921.1| PREDICTED: CBS domain-containing protein CBS... 79 5e-13 ref|NP_196647.1| CBS domain-containing protein [Arabidopsis thal... 79 6e-13 ref|XP_002331597.1| predicted protein [Populus trichocarpa] gi|5... 79 6e-13 >ref|XP_004490743.1| PREDICTED: CBS domain-containing protein CBSX3, mitochondrial-like isoform X2 [Cicer arietinum] Length = 205 Score = 82.8 bits (203), Expect = 4e-14 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = -3 Query: 363 IRHIPVVNKKSMIGMVSIGDVVRAVVSEHREELSRLNAYIQGGY 232 IRHIPV+N+K MIGMVSIGDVVRAVVSEHR+EL RLNAYIQGGY Sbjct: 162 IRHIPVINEKGMIGMVSIGDVVRAVVSEHRQELDRLNAYIQGGY 205 >ref|XP_004490742.1| PREDICTED: CBS domain-containing protein CBSX3, mitochondrial-like isoform X1 [Cicer arietinum] Length = 211 Score = 82.8 bits (203), Expect = 4e-14 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = -3 Query: 363 IRHIPVVNKKSMIGMVSIGDVVRAVVSEHREELSRLNAYIQGGY 232 IRHIPV+N+K MIGMVSIGDVVRAVVSEHR+EL RLNAYIQGGY Sbjct: 168 IRHIPVINEKGMIGMVSIGDVVRAVVSEHRQELDRLNAYIQGGY 211 >ref|XP_002526389.1| conserved hypothetical protein [Ricinus communis] gi|223534251|gb|EEF35965.1| conserved hypothetical protein [Ricinus communis] Length = 206 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -3 Query: 363 IRHIPVVNKKSMIGMVSIGDVVRAVVSEHREELSRLNAYIQGGY 232 IRHIPV+N K M+GM+SIGDVVRAVV+EHREEL RLNAYIQGGY Sbjct: 163 IRHIPVINDKDMVGMLSIGDVVRAVVAEHREELERLNAYIQGGY 206 >ref|XP_006464969.1| PREDICTED: CBS domain-containing protein CBSX3, mitochondrial-like [Citrus sinensis] Length = 205 Score = 80.1 bits (196), Expect = 3e-13 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = -3 Query: 363 IRHIPVVNKKSMIGMVSIGDVVRAVVSEHREELSRLNAYIQGGY 232 IRHIPV++ K MIGMVSIGDVVRAVVSEHREEL+RLNA+IQGGY Sbjct: 162 IRHIPVIDDKGMIGMVSIGDVVRAVVSEHREELNRLNAFIQGGY 205 >gb|EMJ08681.1| hypothetical protein PRUPE_ppa011584mg [Prunus persica] Length = 205 Score = 80.1 bits (196), Expect = 3e-13 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -3 Query: 363 IRHIPVVNKKSMIGMVSIGDVVRAVVSEHREELSRLNAYIQGGY 232 IRHIPV++ + MIGMVSIGDVVRAVVSEHREEL RLNAYIQGGY Sbjct: 162 IRHIPVIDDRGMIGMVSIGDVVRAVVSEHREELDRLNAYIQGGY 205 >emb|CBI15781.3| unnamed protein product [Vitis vinifera] Length = 262 Score = 80.1 bits (196), Expect = 3e-13 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -3 Query: 363 IRHIPVVNKKSMIGMVSIGDVVRAVVSEHREELSRLNAYIQGGY 232 IRHIPV++ K MIGMVSIGDVVRAVV+EHREEL RLNAYIQGGY Sbjct: 219 IRHIPVIDDKEMIGMVSIGDVVRAVVTEHREELDRLNAYIQGGY 262 >ref|XP_002319991.1| hypothetical protein POPTR_0013s15730g [Populus trichocarpa] gi|566201546|ref|XP_006376574.1| hypothetical protein POPTR_0013s15730g [Populus trichocarpa] gi|222858367|gb|EEE95914.1| hypothetical protein POPTR_0013s15730g [Populus trichocarpa] gi|550325940|gb|ERP54371.1| hypothetical protein POPTR_0013s15730g [Populus trichocarpa] Length = 205 Score = 80.1 bits (196), Expect = 3e-13 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -3 Query: 363 IRHIPVVNKKSMIGMVSIGDVVRAVVSEHREELSRLNAYIQGGY 232 IRHIPV++ K MIGMVSIGDVVRAVVSEHREE+ RLNAYIQGGY Sbjct: 162 IRHIPVIDDKEMIGMVSIGDVVRAVVSEHREEVDRLNAYIQGGY 205 >ref|XP_002262902.1| PREDICTED: CBS domain-containing protein CBSX3, mitochondrial isoform 1 [Vitis vinifera] gi|225434279|ref|XP_002262927.1| PREDICTED: CBS domain-containing protein CBSX3, mitochondrial isoform 2 [Vitis vinifera] gi|225434281|ref|XP_002262956.1| PREDICTED: CBS domain-containing protein CBSX3, mitochondrial isoform 3 [Vitis vinifera] Length = 205 Score = 80.1 bits (196), Expect = 3e-13 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -3 Query: 363 IRHIPVVNKKSMIGMVSIGDVVRAVVSEHREELSRLNAYIQGGY 232 IRHIPV++ K MIGMVSIGDVVRAVV+EHREEL RLNAYIQGGY Sbjct: 162 IRHIPVIDDKEMIGMVSIGDVVRAVVTEHREELDRLNAYIQGGY 205 >gb|ABK64186.1| CBS domain-containing protein [Solenostemon scutellarioides] Length = 202 Score = 80.1 bits (196), Expect = 3e-13 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -3 Query: 363 IRHIPVVNKKSMIGMVSIGDVVRAVVSEHREELSRLNAYIQGGY 232 IRHIPVVN+ MIGMVSIGDVVRAVV EHREEL+RLNAYIQGGY Sbjct: 159 IRHIPVVNEGGMIGMVSIGDVVRAVVREHREELNRLNAYIQGGY 202 >ref|XP_003616097.1| Cbs domain protein [Medicago truncatula] gi|355517432|gb|AES99055.1| Cbs domain protein [Medicago truncatula] Length = 254 Score = 79.7 bits (195), Expect = 4e-13 Identities = 37/44 (84%), Positives = 40/44 (90%) Frame = -3 Query: 363 IRHIPVVNKKSMIGMVSIGDVVRAVVSEHREELSRLNAYIQGGY 232 IRHIPV+N K M+GMVSIGDVVRAVV EHR+EL RLNAYIQGGY Sbjct: 211 IRHIPVINDKGMLGMVSIGDVVRAVVGEHRQELDRLNAYIQGGY 254 >ref|XP_003616096.1| Cbs domain protein [Medicago truncatula] gi|355517431|gb|AES99054.1| Cbs domain protein [Medicago truncatula] Length = 242 Score = 79.7 bits (195), Expect = 4e-13 Identities = 37/44 (84%), Positives = 40/44 (90%) Frame = -3 Query: 363 IRHIPVVNKKSMIGMVSIGDVVRAVVSEHREELSRLNAYIQGGY 232 IRHIPV+N K M+GMVSIGDVVRAVV EHR+EL RLNAYIQGGY Sbjct: 199 IRHIPVINDKGMLGMVSIGDVVRAVVGEHRQELDRLNAYIQGGY 242 >ref|XP_003616095.1| Cbs domain protein [Medicago truncatula] gi|217073214|gb|ACJ84966.1| unknown [Medicago truncatula] gi|355517430|gb|AES99053.1| Cbs domain protein [Medicago truncatula] gi|388522955|gb|AFK49539.1| unknown [Medicago truncatula] Length = 205 Score = 79.7 bits (195), Expect = 4e-13 Identities = 37/44 (84%), Positives = 40/44 (90%) Frame = -3 Query: 363 IRHIPVVNKKSMIGMVSIGDVVRAVVSEHREELSRLNAYIQGGY 232 IRHIPV+N K M+GMVSIGDVVRAVV EHR+EL RLNAYIQGGY Sbjct: 162 IRHIPVINDKGMLGMVSIGDVVRAVVGEHRQELDRLNAYIQGGY 205 >ref|XP_006840268.1| hypothetical protein AMTR_s00045p00043360 [Amborella trichopoda] gi|548841986|gb|ERN01943.1| hypothetical protein AMTR_s00045p00043360 [Amborella trichopoda] Length = 257 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -3 Query: 363 IRHIPVVNKKSMIGMVSIGDVVRAVVSEHREELSRLNAYIQGGY 232 IRHIPV++ K M+GMVSIGDVVRAVVSEHR+EL RLNAYIQGGY Sbjct: 214 IRHIPVIDGKDMVGMVSIGDVVRAVVSEHRDELDRLNAYIQGGY 257 >gb|EOX90565.1| Cystathionine beta-synthase (CBS) family protein isoform 2 [Theobroma cacao] Length = 199 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -3 Query: 363 IRHIPVVNKKSMIGMVSIGDVVRAVVSEHREELSRLNAYIQGGY 232 IRHIPV+++K M+GMVSIGDVVRAVV EHREEL RLNAYIQGGY Sbjct: 156 IRHIPVIDEKGMVGMVSIGDVVRAVVIEHREELDRLNAYIQGGY 199 >gb|EOX90564.1| Cystathionine beta-synthase (CBS) family protein isoform 1 [Theobroma cacao] Length = 205 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -3 Query: 363 IRHIPVVNKKSMIGMVSIGDVVRAVVSEHREELSRLNAYIQGGY 232 IRHIPV+++K M+GMVSIGDVVRAVV EHREEL RLNAYIQGGY Sbjct: 162 IRHIPVIDEKGMVGMVSIGDVVRAVVIEHREELDRLNAYIQGGY 205 >ref|XP_006289085.1| hypothetical protein CARUB_v10002490mg [Capsella rubella] gi|482557791|gb|EOA21983.1| hypothetical protein CARUB_v10002490mg [Capsella rubella] Length = 206 Score = 79.3 bits (194), Expect = 5e-13 Identities = 38/44 (86%), Positives = 40/44 (90%) Frame = -3 Query: 363 IRHIPVVNKKSMIGMVSIGDVVRAVVSEHREELSRLNAYIQGGY 232 IRHIPV+ K MIGMVSIGDVVRAVVSEHREEL RLNA+IQGGY Sbjct: 163 IRHIPVIQDKGMIGMVSIGDVVRAVVSEHREELQRLNAFIQGGY 206 >ref|XP_004154564.1| PREDICTED: LOW QUALITY PROTEIN: CBS domain-containing protein CBSX3, mitochondrial-like [Cucumis sativus] Length = 206 Score = 79.3 bits (194), Expect = 5e-13 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -3 Query: 363 IRHIPVVNKKSMIGMVSIGDVVRAVVSEHREELSRLNAYIQGGY 232 IRHIPV+++K M GMVSIGDVVRAVVSEHREEL RLNAYIQGGY Sbjct: 163 IRHIPVIDEKGMKGMVSIGDVVRAVVSEHREELDRLNAYIQGGY 206 >ref|XP_004139921.1| PREDICTED: CBS domain-containing protein CBSX3, mitochondrial-like isoform 1 [Cucumis sativus] gi|449444318|ref|XP_004139922.1| PREDICTED: CBS domain-containing protein CBSX3, mitochondrial-like isoform 2 [Cucumis sativus] Length = 206 Score = 79.3 bits (194), Expect = 5e-13 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -3 Query: 363 IRHIPVVNKKSMIGMVSIGDVVRAVVSEHREELSRLNAYIQGGY 232 IRHIPV+++K M GMVSIGDVVRAVVSEHREEL RLNAYIQGGY Sbjct: 163 IRHIPVIDEKGMKGMVSIGDVVRAVVSEHREELDRLNAYIQGGY 206 >ref|NP_196647.1| CBS domain-containing protein [Arabidopsis thaliana] gi|20455364|sp|Q9LEV3.1|CBSX3_ARATH RecName: Full=CBS domain-containing protein CBSX3, mitochondrial; Flags: Precursor gi|13605728|gb|AAK32857.1|AF361845_1 AT5g10860/T30N20_130 [Arabidopsis thaliana] gi|8979720|emb|CAB96841.1| putative protein [Arabidopsis thaliana] gi|17978887|gb|AAL47413.1| AT5g10860/T30N20_130 [Arabidopsis thaliana] gi|332004220|gb|AED91603.1| CBS domain-containing protein [Arabidopsis thaliana] Length = 206 Score = 79.0 bits (193), Expect = 6e-13 Identities = 38/44 (86%), Positives = 39/44 (88%) Frame = -3 Query: 363 IRHIPVVNKKSMIGMVSIGDVVRAVVSEHREELSRLNAYIQGGY 232 IRHIPV+ K MIGMVSIGDVVRAVV EHREEL RLNAYIQGGY Sbjct: 163 IRHIPVIKDKGMIGMVSIGDVVRAVVHEHREELQRLNAYIQGGY 206 >ref|XP_002331597.1| predicted protein [Populus trichocarpa] gi|566210466|ref|XP_006372319.1| hypothetical protein POPTR_0017s00540g [Populus trichocarpa] gi|550318935|gb|ERP50116.1| hypothetical protein POPTR_0017s00540g [Populus trichocarpa] Length = 205 Score = 79.0 bits (193), Expect = 6e-13 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -3 Query: 363 IRHIPVVNKKSMIGMVSIGDVVRAVVSEHREELSRLNAYIQGGY 232 IRHIPV++ K MIGMVSIGDVVRAVVSE+REEL RLNAYIQGGY Sbjct: 162 IRHIPVIDDKGMIGMVSIGDVVRAVVSEYREELDRLNAYIQGGY 205