BLASTX nr result
ID: Zingiber23_contig00005143
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00005143 (419 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002437177.1| hypothetical protein SORBIDRAFT_10g022400 [S... 57 3e-06 >ref|XP_002437177.1| hypothetical protein SORBIDRAFT_10g022400 [Sorghum bicolor] gi|241915400|gb|EER88544.1| hypothetical protein SORBIDRAFT_10g022400 [Sorghum bicolor] Length = 331 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/43 (55%), Positives = 35/43 (81%) Frame = -3 Query: 168 RSGITMLDQWLPSTLASIFGWFTPTVLFVLVNLVIGTIAIASK 40 R G ML++ +P+ L+++ GWFTP VLFV++N+VIGTIA+ SK Sbjct: 59 RHGGAMLEEAIPALLSAVHGWFTPAVLFVVLNIVIGTIAVTSK 101