BLASTX nr result
ID: Zingiber23_contig00004852
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00004852 (365 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB66631.1| Pyrophosphate-energized vacuolar membrane proton ... 109 3e-22 ref|XP_006646987.1| PREDICTED: pyrophosphate-energized vacuolar ... 109 3e-22 gb|EOY31219.1| Inorganic H pyrophosphatase family protein isofor... 109 3e-22 ref|XP_004303283.1| PREDICTED: pyrophosphate-energized vacuolar ... 109 3e-22 gb|EMJ18358.1| hypothetical protein PRUPE_ppa001776mg [Prunus pe... 109 3e-22 dbj|BAD25066.1| putative inorganic diphosphatase [Oryza sativa J... 109 3e-22 dbj|BAD02277.1| vacuolar proton pyrophosphatase [Oryza sativa Ja... 109 3e-22 emb|CAA58701.1| inorganic pyrophosphatase [Nicotiana tabacum] 109 3e-22 dbj|BAC41250.1| vacuolar proton-inorganic pyrophosphatase [Pyrus... 109 3e-22 ref|XP_003632833.1| PREDICTED: pyrophosphate-energized vacuolar ... 109 3e-22 ref|XP_003632767.1| PREDICTED: pyrophosphate-energized vacuolar ... 109 3e-22 ref|NP_001046107.2| Os02g0184200 [Oryza sativa Japonica Group] g... 109 3e-22 ref|XP_002530755.1| Pyrophosphate-energized vacuolar membrane pr... 109 3e-22 ref|XP_002331062.1| vacuolar H+-translocating inorganic pyrophos... 109 3e-22 gb|ABK94904.1| unknown [Populus trichocarpa] 109 3e-22 ref|XP_002325187.1| vacuolar H+-translocating inorganic pyrophos... 109 3e-22 ref|XP_002273207.1| PREDICTED: pyrophosphate-energized vacuolar ... 109 3e-22 gb|ABO45933.1| vacuolar H+-pyrophosphatase [Halostachys caspica] 109 3e-22 gb|EAY84758.1| hypothetical protein OsI_06126 [Oryza sativa Indi... 109 3e-22 gb|ABF85694.1| inorganic pyrophosphatase [Nicotiana rustica] 109 3e-22 >gb|EXB66631.1| Pyrophosphate-energized vacuolar membrane proton pump [Morus notabilis] Length = 764 Score = 109 bits (273), Expect = 3e-22 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 363 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKLF 202 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFK+F Sbjct: 711 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 764 >ref|XP_006646987.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like [Oryza brachyantha] Length = 764 Score = 109 bits (273), Expect = 3e-22 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 363 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKLF 202 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGG+LFKLF Sbjct: 711 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGILFKLF 764 >gb|EOY31219.1| Inorganic H pyrophosphatase family protein isoform 1 [Theobroma cacao] Length = 770 Score = 109 bits (273), Expect = 3e-22 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 363 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKLF 202 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFK+F Sbjct: 717 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 770 >ref|XP_004303283.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 1-like [Fragaria vesca subsp. vesca] Length = 767 Score = 109 bits (273), Expect = 3e-22 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 363 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKLF 202 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFK+F Sbjct: 714 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 767 >gb|EMJ18358.1| hypothetical protein PRUPE_ppa001776mg [Prunus persica] Length = 767 Score = 109 bits (273), Expect = 3e-22 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 363 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKLF 202 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFK+F Sbjct: 714 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 767 >dbj|BAD25066.1| putative inorganic diphosphatase [Oryza sativa Japonica Group] gi|222622322|gb|EEE56454.1| hypothetical protein OsJ_05651 [Oryza sativa Japonica Group] Length = 770 Score = 109 bits (273), Expect = 3e-22 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 363 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKLF 202 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGG+LFKLF Sbjct: 717 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGILFKLF 770 >dbj|BAD02277.1| vacuolar proton pyrophosphatase [Oryza sativa Japonica Group] Length = 770 Score = 109 bits (273), Expect = 3e-22 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 363 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKLF 202 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGG+LFKLF Sbjct: 717 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGILFKLF 770 >emb|CAA58701.1| inorganic pyrophosphatase [Nicotiana tabacum] Length = 765 Score = 109 bits (273), Expect = 3e-22 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 363 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKLF 202 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFK+F Sbjct: 712 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 765 >dbj|BAC41250.1| vacuolar proton-inorganic pyrophosphatase [Pyrus communis] Length = 767 Score = 109 bits (273), Expect = 3e-22 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 363 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKLF 202 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFK+F Sbjct: 714 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 767 >ref|XP_003632833.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 1-like [Vitis vinifera] Length = 418 Score = 109 bits (273), Expect = 3e-22 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 363 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKLF 202 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFK+F Sbjct: 365 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 418 >ref|XP_003632767.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 1-like [Vitis vinifera] gi|297743533|emb|CBI36400.3| unnamed protein product [Vitis vinifera] Length = 395 Score = 109 bits (273), Expect = 3e-22 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 363 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKLF 202 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFK+F Sbjct: 342 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 395 >ref|NP_001046107.2| Os02g0184200 [Oryza sativa Japonica Group] gi|255670659|dbj|BAF08021.2| Os02g0184200, partial [Oryza sativa Japonica Group] Length = 360 Score = 109 bits (273), Expect = 3e-22 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 363 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKLF 202 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGG+LFKLF Sbjct: 307 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGILFKLF 360 >ref|XP_002530755.1| Pyrophosphate-energized vacuolar membrane proton pump, putative [Ricinus communis] gi|223529671|gb|EEF31615.1| Pyrophosphate-energized vacuolar membrane proton pump, putative [Ricinus communis] Length = 767 Score = 109 bits (273), Expect = 3e-22 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 363 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKLF 202 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFK+F Sbjct: 714 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 767 >ref|XP_002331062.1| vacuolar H+-translocating inorganic pyrophosphatase [Populus trichocarpa] gi|566174770|ref|XP_006381091.1| Pyrophosphate-energized vacuolar membrane proton pump family protein [Populus trichocarpa] gi|550335597|gb|ERP58888.1| Pyrophosphate-energized vacuolar membrane proton pump family protein [Populus trichocarpa] Length = 768 Score = 109 bits (273), Expect = 3e-22 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 363 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKLF 202 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFK+F Sbjct: 715 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 768 >gb|ABK94904.1| unknown [Populus trichocarpa] Length = 288 Score = 109 bits (273), Expect = 3e-22 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 363 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKLF 202 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFK+F Sbjct: 235 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 288 >ref|XP_002325187.1| vacuolar H+-translocating inorganic pyrophosphatase [Populus trichocarpa] gi|566259733|ref|XP_006389422.1| Pyrophosphate-energized vacuolar membrane proton pump family protein [Populus trichocarpa] gi|118486585|gb|ABK95131.1| unknown [Populus trichocarpa] gi|550312216|gb|ERP48336.1| Pyrophosphate-energized vacuolar membrane proton pump family protein [Populus trichocarpa] Length = 768 Score = 109 bits (273), Expect = 3e-22 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 363 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKLF 202 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFK+F Sbjct: 715 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 768 >ref|XP_002273207.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump [Vitis vinifera] gi|297743526|emb|CBI36393.3| unnamed protein product [Vitis vinifera] Length = 767 Score = 109 bits (273), Expect = 3e-22 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 363 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKLF 202 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFK+F Sbjct: 714 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 767 >gb|ABO45933.1| vacuolar H+-pyrophosphatase [Halostachys caspica] Length = 764 Score = 109 bits (273), Expect = 3e-22 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 363 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKLF 202 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFK+F Sbjct: 711 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 764 >gb|EAY84758.1| hypothetical protein OsI_06126 [Oryza sativa Indica Group] Length = 268 Score = 109 bits (273), Expect = 3e-22 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 363 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKLF 202 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGG+LFKLF Sbjct: 215 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGILFKLF 268 >gb|ABF85694.1| inorganic pyrophosphatase [Nicotiana rustica] Length = 765 Score = 109 bits (273), Expect = 3e-22 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 363 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKLF 202 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFK+F Sbjct: 712 SDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 765