BLASTX nr result
ID: Zingiber23_contig00002332
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00002332 (224 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEC74492.1| hypothetical protein OsI_09962 [Oryza sativa Indi... 57 3e-06 ref|XP_006651024.1| PREDICTED: uncharacterized protein LOC102704... 55 8e-06 >gb|EEC74492.1| hypothetical protein OsI_09962 [Oryza sativa Indica Group] Length = 763 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/45 (57%), Positives = 32/45 (71%), Gaps = 1/45 (2%) Frame = -2 Query: 223 LVLQGLLDSQ-DQNRAFRVIMTELGFLEDIFFSQYPIIFGCGFPI 92 LV GL+ S D+ R FRVI ELGF DI F++YPI+F CGFP+ Sbjct: 334 LVFDGLITSDIDEERTFRVIRAELGFARDISFTKYPILFSCGFPV 378 >ref|XP_006651024.1| PREDICTED: uncharacterized protein LOC102704877 [Oryza brachyantha] Length = 743 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 1/58 (1%) Frame = -2 Query: 223 LVLQGLLDSQ-DQNRAFRVIMTELGFLEDIFFSQYPIIFGCGFPIYNYXXXXXXLGAT 53 LV GL+ S D R FRV+ ELGF DI F++YPI+F CGFP+ + LGA+ Sbjct: 304 LVFDGLITSGIDAERTFRVVRAELGFARDISFTKYPILFSCGFPVVSVVLFLATLGAS 361