BLASTX nr result
ID: Zingiber23_contig00002227
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00002227 (334 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632757.1| PREDICTED: auxin-repressed 12.5 kDa protein-... 56 4e-06 >ref|XP_003632757.1| PREDICTED: auxin-repressed 12.5 kDa protein-like [Vitis vinifera] gi|297742955|emb|CBI35822.3| unnamed protein product [Vitis vinifera] Length = 126 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/55 (52%), Positives = 34/55 (61%), Gaps = 3/55 (5%) Frame = -1 Query: 292 MGILHQLWDDTVAGPPP---LGKLRKYTSFPXXXXXXXXXXXXAQITRSVTILRT 137 MG L +LWD+TVAGPPP LGKLRKY S Q+TRS+TIL+T Sbjct: 1 MGFLDKLWDETVAGPPPETGLGKLRKYKSLSAARSPPIINPDEVQVTRSITILKT 55