BLASTX nr result
ID: Zingiber23_contig00001384
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00001384 (233 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB39391.1| 40S ribosomal protein S18 [Morus notabilis] 79 5e-13 ref|XP_006434520.1| hypothetical protein CICLE_v10002764mg [Citr... 79 6e-13 ref|XP_006419931.1| hypothetical protein CICLE_v10006140mg [Citr... 79 6e-13 gb|EOY16823.1| S18 ribosomal protein [Theobroma cacao] gi|508724... 79 6e-13 ref|XP_004139687.1| PREDICTED: 40S ribosomal protein S18-like [C... 79 6e-13 gb|ADR71282.1| 40S ribosomal protein S18C [Hevea brasiliensis] 79 6e-13 ref|XP_006574786.1| PREDICTED: 40S ribosomal protein S18 [Glycin... 79 6e-13 ref|NP_001235572.1| uncharacterized protein LOC100306474 [Glycin... 79 6e-13 ref|XP_002520719.1| 40S ribosomal protein S18, putative [Ricinus... 79 6e-13 ref|XP_002524340.1| 40S ribosomal protein S18, putative [Ricinus... 79 6e-13 ref|XP_002307515.1| 40S ribosomal protein S18 [Populus trichocar... 79 6e-13 ref|XP_006288747.1| hypothetical protein CARUB_v10002063mg, part... 78 1e-12 ref|NP_001236608.1| uncharacterized protein LOC100500087 [Glycin... 78 1e-12 ref|NP_001238100.1| uncharacterized protein LOC100306646 [Glycin... 78 1e-12 gb|ACY30447.1| RPS18.A-like protein [Liriodendron tulipifera] 78 1e-12 emb|CBI28706.3| unnamed protein product [Vitis vinifera] 78 1e-12 gb|EXB41289.1| 40S ribosomal protein S18 [Morus notabilis] 77 2e-12 ref|NP_173692.1| 40S ribosomal protein S18 [Arabidopsis thaliana... 77 2e-12 ref|XP_006415047.1| hypothetical protein EUTSA_v10009003mg [Eutr... 77 2e-12 ref|XP_006844400.1| hypothetical protein AMTR_s00142p00099380 [A... 77 2e-12 >gb|EXB39391.1| 40S ribosomal protein S18 [Morus notabilis] Length = 225 Score = 79.3 bits (194), Expect = 5e-13 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +1 Query: 109 VAMSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR 231 +AMSLV NEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR Sbjct: 72 LAMSLVTNEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR 112 >ref|XP_006434520.1| hypothetical protein CICLE_v10002764mg [Citrus clementina] gi|568838213|ref|XP_006473109.1| PREDICTED: 40S ribosomal protein S18-like [Citrus sinensis] gi|557536642|gb|ESR47760.1| hypothetical protein CICLE_v10002764mg [Citrus clementina] Length = 152 Score = 79.0 bits (193), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +1 Query: 115 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR 231 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR 39 >ref|XP_006419931.1| hypothetical protein CICLE_v10006140mg [Citrus clementina] gi|568872460|ref|XP_006489386.1| PREDICTED: 40S ribosomal protein S18-like [Citrus sinensis] gi|557521804|gb|ESR33171.1| hypothetical protein CICLE_v10006140mg [Citrus clementina] Length = 152 Score = 79.0 bits (193), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +1 Query: 115 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR 231 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR 39 >gb|EOY16823.1| S18 ribosomal protein [Theobroma cacao] gi|508724927|gb|EOY16824.1| S18 ribosomal protein isoform 1 [Theobroma cacao] gi|508724928|gb|EOY16825.1| S18 ribosomal protein isoform 1 [Theobroma cacao] Length = 152 Score = 79.0 bits (193), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +1 Query: 115 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR 231 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR 39 >ref|XP_004139687.1| PREDICTED: 40S ribosomal protein S18-like [Cucumis sativus] gi|449525091|ref|XP_004169553.1| PREDICTED: 40S ribosomal protein S18-like [Cucumis sativus] Length = 152 Score = 79.0 bits (193), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +1 Query: 115 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR 231 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR 39 >gb|ADR71282.1| 40S ribosomal protein S18C [Hevea brasiliensis] Length = 152 Score = 79.0 bits (193), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +1 Query: 115 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR 231 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR 39 >ref|XP_006574786.1| PREDICTED: 40S ribosomal protein S18 [Glycine max] Length = 152 Score = 79.0 bits (193), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +1 Query: 115 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR 231 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR 39 >ref|NP_001235572.1| uncharacterized protein LOC100306474 [Glycine max] gi|255628659|gb|ACU14674.1| unknown [Glycine max] Length = 152 Score = 79.0 bits (193), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +1 Query: 115 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR 231 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR 39 >ref|XP_002520719.1| 40S ribosomal protein S18, putative [Ricinus communis] gi|223540104|gb|EEF41681.1| 40S ribosomal protein S18, putative [Ricinus communis] gi|313586541|gb|ADR71281.1| 40S ribosomal protein S18A [Hevea brasiliensis] Length = 152 Score = 79.0 bits (193), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +1 Query: 115 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR 231 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR 39 >ref|XP_002524340.1| 40S ribosomal protein S18, putative [Ricinus communis] gi|223536431|gb|EEF38080.1| 40S ribosomal protein S18, putative [Ricinus communis] Length = 152 Score = 79.0 bits (193), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +1 Query: 115 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR 231 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR 39 >ref|XP_002307515.1| 40S ribosomal protein S18 [Populus trichocarpa] gi|222856964|gb|EEE94511.1| 40S ribosomal protein S18 [Populus trichocarpa] Length = 152 Score = 79.0 bits (193), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +1 Query: 115 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR 231 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR 39 >ref|XP_006288747.1| hypothetical protein CARUB_v10002063mg, partial [Capsella rubella] gi|482557453|gb|EOA21645.1| hypothetical protein CARUB_v10002063mg, partial [Capsella rubella] Length = 183 Score = 78.2 bits (191), Expect = 1e-12 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +1 Query: 109 VAMSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR 231 + MSLVANE+FQHILRVLNTNVDGKQKIMFALTSIKGIGRR Sbjct: 30 IKMSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRR 70 >ref|NP_001236608.1| uncharacterized protein LOC100500087 [Glycine max] gi|255629053|gb|ACU14871.1| unknown [Glycine max] Length = 152 Score = 78.2 bits (191), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +1 Query: 115 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR 231 MSLVANEDFQHILRVLNTNVDGKQKIMFA+TSIKGIGRR Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFAMTSIKGIGRR 39 >ref|NP_001238100.1| uncharacterized protein LOC100306646 [Glycine max] gi|255629171|gb|ACU14930.1| unknown [Glycine max] Length = 152 Score = 78.2 bits (191), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +1 Query: 115 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR 231 MSLVANEDFQHILRVLNTNVDGKQKIMFA+TSIKGIGRR Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFAMTSIKGIGRR 39 >gb|ACY30447.1| RPS18.A-like protein [Liriodendron tulipifera] Length = 197 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +1 Query: 109 VAMSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR 231 ++ SL+ANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR Sbjct: 47 ISKSLIANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR 87 >emb|CBI28706.3| unnamed protein product [Vitis vinifera] Length = 912 Score = 77.8 bits (190), Expect = 1e-12 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +1 Query: 109 VAMSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR 231 + MSLVANE+FQHILRVLNTNVDGKQKIMFALTSIKGIGRR Sbjct: 759 LTMSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRR 799 >gb|EXB41289.1| 40S ribosomal protein S18 [Morus notabilis] Length = 152 Score = 77.4 bits (189), Expect = 2e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +1 Query: 115 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR 231 MSLVANE+FQHILRVLNTNVDGKQKIMFALTSIKGIGRR Sbjct: 1 MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRR 39 >ref|NP_173692.1| 40S ribosomal protein S18 [Arabidopsis thaliana] gi|15234790|ref|NP_192718.1| 40S ribosomal protein S18 [Arabidopsis thaliana] gi|18399100|ref|NP_564434.1| 40S ribosomal protein S18 [Arabidopsis thaliana] gi|297809155|ref|XP_002872461.1| hypothetical protein ARALYDRAFT_489832 [Arabidopsis lyrata subsp. lyrata] gi|297845304|ref|XP_002890533.1| hypothetical protein ARALYDRAFT_472522 [Arabidopsis lyrata subsp. lyrata] gi|297851838|ref|XP_002893800.1| hypothetical protein ARALYDRAFT_473557 [Arabidopsis lyrata subsp. lyrata] gi|464707|sp|P34788.1|RS18_ARATH RecName: Full=40S ribosomal protein S18 gi|10086474|gb|AAG12534.1|AC015446_15 ribosomal protein S18 [Arabidopsis thaliana] gi|10092450|gb|AAG12853.1|AC079286_10 40S ribosomal protein S18; 25853-24673 [Arabidopsis thaliana] gi|14423408|gb|AAK62386.1|AF386941_1 S18.A ribosomal protein [Arabidopsis thaliana] gi|15724158|gb|AAL06471.1|AF411781_1 At1g22780/T22J18_5 [Arabidopsis thaliana] gi|405613|emb|CAA80684.1| ribosomal protein S18A [Arabidopsis thaliana] gi|434343|emb|CAA82273.1| S18 ribosomal protein [Arabidopsis thaliana] gi|434345|emb|CAA82274.1| S18 ribosomal protein [Arabidopsis thaliana] gi|434906|emb|CAA82275.1| S18 ribosomal protein [Arabidopsis thaliana] gi|2505871|emb|CAA72909.1| ribosomal protein S18A [Arabidopsis thaliana] gi|3287678|gb|AAC25506.1| Match to ribosomal S18 gene mRNA gb|Z28701, DNA gb|Z23165 from A. thaliana. ESTs gb|T21121, gb|Z17755, gb|R64776 and gb|R30430 come from this gene [Arabidopsis thaliana] gi|4538910|emb|CAB39647.1| S18.A ribosomal protein [Arabidopsis thaliana] gi|7267675|emb|CAB78103.1| S18.A ribosomal protein [Arabidopsis thaliana] gi|14334584|gb|AAK59471.1| putative ribosomal protein S18 [Arabidopsis thaliana] gi|17979113|gb|AAL47500.1| putative ribosomal protein S18 [Arabidopsis thaliana] gi|21555397|gb|AAM63849.1| ribosomal protein S18, putative [Arabidopsis thaliana] gi|21592452|gb|AAM64403.1| ribosomal protein S18, putative [Arabidopsis thaliana] gi|21593027|gb|AAM64976.1| ribosomal protein S18, putative [Arabidopsis thaliana] gi|30102858|gb|AAP21347.1| At4g09800 [Arabidopsis thaliana] gi|56236126|gb|AAV84519.1| At1g22780 [Arabidopsis thaliana] gi|98961089|gb|ABF59028.1| At1g22780 [Arabidopsis thaliana] gi|145713244|gb|ABP96570.1| pointed first leaf [Arabidopsis thaliana] gi|145713246|gb|ABP96571.1| pointed first leaf [Arabidopsis thaliana] gi|145713248|gb|ABP96572.1| pointed first leaf [Arabidopsis thaliana] gi|145713250|gb|ABP96573.1| pointed first leaf [Arabidopsis thaliana] gi|145713252|gb|ABP96574.1| pointed first leaf [Arabidopsis thaliana] gi|145713254|gb|ABP96575.1| pointed first leaf [Arabidopsis thaliana] gi|145713256|gb|ABP96576.1| pointed first leaf [Arabidopsis thaliana] gi|145713258|gb|ABP96577.1| pointed first leaf [Arabidopsis thaliana] gi|145713260|gb|ABP96578.1| pointed first leaf [Arabidopsis thaliana] gi|145713262|gb|ABP96579.1| pointed first leaf [Arabidopsis thaliana] gi|145713264|gb|ABP96580.1| pointed first leaf [Arabidopsis thaliana] gi|145713266|gb|ABP96581.1| pointed first leaf [Arabidopsis thaliana] gi|145713268|gb|ABP96582.1| pointed first leaf [Arabidopsis thaliana] gi|145713270|gb|ABP96583.1| pointed first leaf [Arabidopsis thaliana] gi|145713272|gb|ABP96584.1| pointed first leaf [Arabidopsis thaliana] gi|145713274|gb|ABP96585.1| pointed first leaf [Arabidopsis thaliana] gi|145713276|gb|ABP96586.1| pointed first leaf [Arabidopsis thaliana] gi|145713278|gb|ABP96587.1| pointed first leaf [Arabidopsis thaliana] gi|145713280|gb|ABP96588.1| pointed first leaf [Arabidopsis thaliana] gi|145713282|gb|ABP96589.1| pointed first leaf [Arabidopsis thaliana] gi|145713284|gb|ABP96590.1| pointed first leaf [Arabidopsis thaliana] gi|297318298|gb|EFH48720.1| hypothetical protein ARALYDRAFT_489832 [Arabidopsis lyrata subsp. lyrata] gi|297336375|gb|EFH66792.1| hypothetical protein ARALYDRAFT_472522 [Arabidopsis lyrata subsp. lyrata] gi|297339642|gb|EFH70059.1| hypothetical protein ARALYDRAFT_473557 [Arabidopsis lyrata subsp. lyrata] gi|332192166|gb|AEE30287.1| 40S ribosomal protein S18 [Arabidopsis thaliana] gi|332193538|gb|AEE31659.1| 40S ribosomal protein S18 [Arabidopsis thaliana] gi|332657400|gb|AEE82800.1| 40S ribosomal protein S18 [Arabidopsis thaliana] Length = 152 Score = 77.4 bits (189), Expect = 2e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +1 Query: 115 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR 231 MSLVANE+FQHILRVLNTNVDGKQKIMFALTSIKGIGRR Sbjct: 1 MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRR 39 >ref|XP_006415047.1| hypothetical protein EUTSA_v10009003mg [Eutrema salsugineum] gi|567163760|ref|XP_006397143.1| hypothetical protein EUTSA_v10029039mg [Eutrema salsugineum] gi|557092818|gb|ESQ33400.1| hypothetical protein EUTSA_v10009003mg [Eutrema salsugineum] gi|557098160|gb|ESQ38596.1| hypothetical protein EUTSA_v10029039mg [Eutrema salsugineum] Length = 152 Score = 77.4 bits (189), Expect = 2e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +1 Query: 115 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR 231 MSLVANE+FQHILRVLNTNVDGKQKIMFALTSIKGIGRR Sbjct: 1 MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRR 39 >ref|XP_006844400.1| hypothetical protein AMTR_s00142p00099380 [Amborella trichopoda] gi|548846846|gb|ERN06075.1| hypothetical protein AMTR_s00142p00099380 [Amborella trichopoda] Length = 152 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = +1 Query: 115 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR 231 MSL+ANEDFQHILRVLNTNVDG+QKIMFALTSIKGIGRR Sbjct: 1 MSLIANEDFQHILRVLNTNVDGRQKIMFALTSIKGIGRR 39