BLASTX nr result
ID: Zingiber23_contig00001327
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00001327 (872 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006473551.1| PREDICTED: uncharacterized protein LOC102624... 67 1e-08 ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799... 66 1e-08 ref|XP_006340664.1| PREDICTED: uncharacterized protein LOC102593... 64 6e-08 ref|XP_006585165.1| PREDICTED: uncharacterized protein LOC102669... 63 1e-07 ref|XP_006362036.1| PREDICTED: uncharacterized protein LOC102590... 62 2e-07 ref|XP_004499194.1| PREDICTED: uncharacterized protein LOC101496... 62 4e-07 ref|XP_004504309.1| PREDICTED: uncharacterized protein LOC101502... 61 6e-07 ref|XP_002887590.1| expressed protein [Arabidopsis lyrata subsp.... 60 8e-07 ref|NP_001119115.1| conserved peptide upstream open reading fram... 60 8e-07 ref|NP_001117603.1| conserved peptide upstream open reading fram... 60 8e-07 ref|XP_004500982.1| PREDICTED: uncharacterized protein LOC101493... 59 2e-06 ref|XP_004248699.1| PREDICTED: uncharacterized protein LOC101260... 59 2e-06 ref|XP_004973272.1| PREDICTED: basic leucine zipper 9-like isofo... 59 3e-06 ref|XP_004289641.1| PREDICTED: uncharacterized protein LOC101313... 57 7e-06 >ref|XP_006473551.1| PREDICTED: uncharacterized protein LOC102624295 [Citrus sinensis] gi|508722951|gb|EOY14848.1| Peptide upstream open reading frame 5 [Theobroma cacao] Length = 41 Score = 66.6 bits (161), Expect = 1e-08 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -1 Query: 113 MSPVISEILLSGFMINSTLRRRSPLVQSFSVVFLYWF 3 MSPV+SEIL SGFMINS+LRRR+ LVQSFSVVFLYWF Sbjct: 1 MSPVVSEILRSGFMINSSLRRRTHLVQSFSVVFLYWF 37 >ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799960 [Glycine max] gi|356564302|ref|XP_003550394.1| PREDICTED: uncharacterized protein LOC100799844 [Glycine max] gi|561034189|gb|ESW32719.1| hypothetical protein PHAVU_001G011900g [Phaseolus vulgaris] Length = 41 Score = 66.2 bits (160), Expect = 1e-08 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -1 Query: 113 MSPVISEILLSGFMINSTLRRRSPLVQSFSVVFLYWF 3 MSPV+SEIL SGFMINS+LRRR+ LVQSFSVVFLYWF Sbjct: 1 MSPVLSEILRSGFMINSSLRRRTHLVQSFSVVFLYWF 37 >ref|XP_006340664.1| PREDICTED: uncharacterized protein LOC102593404 [Solanum tuberosum] Length = 41 Score = 64.3 bits (155), Expect = 6e-08 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -1 Query: 113 MSPVISEILLSGFMINSTLRRRSPLVQSFSVVFLYWF 3 M+PVISE+LLSGF INSTLRR + LVQSFSVVFLYWF Sbjct: 1 MTPVISEVLLSGFTINSTLRRGTHLVQSFSVVFLYWF 37 >ref|XP_006585165.1| PREDICTED: uncharacterized protein LOC102669679 [Glycine max] gi|561032852|gb|ESW31431.1| hypothetical protein PHAVU_002G237700g [Phaseolus vulgaris] Length = 42 Score = 63.2 bits (152), Expect = 1e-07 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -1 Query: 110 SPVISEILLSGFMINSTLRRRSPLVQSFSVVFLYWF 3 SPVISEILLSGF INS+LRRR+ LVQSFSVVFL+WF Sbjct: 3 SPVISEILLSGFTINSSLRRRTHLVQSFSVVFLHWF 38 >ref|XP_006362036.1| PREDICTED: uncharacterized protein LOC102590957 [Solanum tuberosum] Length = 41 Score = 62.4 bits (150), Expect = 2e-07 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -1 Query: 113 MSPVISEILLSGFMINSTLRRRSPLVQSFSVVFLYWF 3 MS ++SE+ LSGFMINST RRR+ LVQSFSVVFLYWF Sbjct: 1 MSAILSELFLSGFMINSTYRRRTHLVQSFSVVFLYWF 37 >ref|XP_004499194.1| PREDICTED: uncharacterized protein LOC101496764 [Cicer arietinum] Length = 41 Score = 61.6 bits (148), Expect = 4e-07 Identities = 29/37 (78%), Positives = 35/37 (94%) Frame = -1 Query: 113 MSPVISEILLSGFMINSTLRRRSPLVQSFSVVFLYWF 3 MSPV+SEIL SGF+I+S+L+RR+ LVQSFSVVFLYWF Sbjct: 1 MSPVLSEILRSGFIIDSSLKRRTHLVQSFSVVFLYWF 37 >ref|XP_004504309.1| PREDICTED: uncharacterized protein LOC101502371 [Cicer arietinum] Length = 39 Score = 60.8 bits (146), Expect = 6e-07 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = -1 Query: 113 MSPVISEILLSGFMINSTLRRRSPLVQSFSVVFLYWF 3 MSPVI EI SGFMINSTLRRR+ LVQSFSVVFLYWF Sbjct: 1 MSPVICEI--SGFMINSTLRRRTHLVQSFSVVFLYWF 35 >ref|XP_002887590.1| expressed protein [Arabidopsis lyrata subsp. lyrata] gi|297333431|gb|EFH63849.1| expressed protein [Arabidopsis lyrata subsp. lyrata] Length = 53 Score = 60.5 bits (145), Expect = 8e-07 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -1 Query: 113 MSPVISEILLSGFMINSTLRRRSPLVQSFSVVFLYWF 3 MSPVISEIL SG I+S+LRRR+ LVQSFSVVFLYWF Sbjct: 13 MSPVISEILRSGLTIDSSLRRRTHLVQSFSVVFLYWF 49 >ref|NP_001119115.1| conserved peptide upstream open reading frame 2 [Arabidopsis thaliana] gi|332660996|gb|AEE86396.1| conserved peptide upstream open reading frame 2 [Arabidopsis thaliana] Length = 42 Score = 60.5 bits (145), Expect = 8e-07 Identities = 30/37 (81%), Positives = 34/37 (91%), Gaps = 1/37 (2%) Frame = -1 Query: 113 MSPVI-SEILLSGFMINSTLRRRSPLVQSFSVVFLYW 6 MSP+I SEI LSGFM+NST+RRR+ LVQSFSVVFLYW Sbjct: 1 MSPIILSEIFLSGFMLNSTIRRRTHLVQSFSVVFLYW 37 >ref|NP_001117603.1| conserved peptide upstream open reading frame 5 [Arabidopsis thaliana] gi|332197591|gb|AEE35712.1| conserved peptide upstream open reading frame 5 [Arabidopsis thaliana] Length = 41 Score = 60.5 bits (145), Expect = 8e-07 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -1 Query: 113 MSPVISEILLSGFMINSTLRRRSPLVQSFSVVFLYWF 3 MSPVISEIL SG I+S+LRRR+ LVQSFSVVFLYWF Sbjct: 1 MSPVISEILRSGLTIDSSLRRRTHLVQSFSVVFLYWF 37 >ref|XP_004500982.1| PREDICTED: uncharacterized protein LOC101493326 [Cicer arietinum] Length = 54 Score = 59.3 bits (142), Expect = 2e-06 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -1 Query: 113 MSPVISEILLSGFMINSTLRRRSPLVQSFSVVFLYWF 3 MS ++SE LLSGF+INS+ RRR+ LVQSFS+VFLYWF Sbjct: 1 MSTILSEFLLSGFIINSSFRRRTHLVQSFSLVFLYWF 37 >ref|XP_004248699.1| PREDICTED: uncharacterized protein LOC101260774 [Solanum lycopersicum] Length = 41 Score = 59.3 bits (142), Expect = 2e-06 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -1 Query: 113 MSPVISEILLSGFMINSTLRRRSPLVQSFSVVFLYWF 3 MS +++E+ L GFMINST RRR+ LVQSFSVVFLYWF Sbjct: 1 MSAILNELFLCGFMINSTYRRRTHLVQSFSVVFLYWF 37 >ref|XP_004973272.1| PREDICTED: basic leucine zipper 9-like isoform X2 [Setaria italica] Length = 147 Score = 58.5 bits (140), Expect = 3e-06 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -1 Query: 113 MSPVISEILLSGFMINSTLRRRSPLVQSFSVVFLYWF 3 MS ++SE +LSGFMINSTLRR + LV SFSVVFLYWF Sbjct: 1 MSQILSEAILSGFMINSTLRRGTHLVLSFSVVFLYWF 37 >ref|XP_004289641.1| PREDICTED: uncharacterized protein LOC101313460 [Fragaria vesca subsp. vesca] Length = 41 Score = 57.4 bits (137), Expect = 7e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -1 Query: 113 MSPVISEILLSGFMINSTLRRRSPLVQSFSVVFLYW 6 MSP +SE+LLS MINST RRR+ LVQSFSVVFLYW Sbjct: 1 MSPTLSELLLSECMINSTYRRRTHLVQSFSVVFLYW 36