BLASTX nr result
ID: Zingiber23_contig00000650
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00000650 (260 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003569083.1| PREDICTED: metallothionein-like protein 2C-l... 58 1e-06 >ref|XP_003569083.1| PREDICTED: metallothionein-like protein 2C-like isoform 1 [Brachypodium distachyon] gi|357134964|ref|XP_003569084.1| PREDICTED: metallothionein-like protein 2C-like isoform 2 [Brachypodium distachyon] Length = 84 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/53 (52%), Positives = 31/53 (58%), Gaps = 11/53 (20%) Frame = +1 Query: 1 CGNGCGGCKMYPD--------MTGETAAAIVHEGS---MEMAAGSEGGNCDCT 126 CGNGCGGCKM+PD MT A H+GS +EMA G E G CDCT Sbjct: 16 CGNGCGGCKMFPDVEASAGATMTTVVMATATHKGSSGGLEMAGGEESGGCDCT 68