BLASTX nr result
ID: Zingiber23_contig00000417
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00000417 (328 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD38707.1| chloroplast chlorophyll a/b binding protein [Pach... 223 2e-56 dbj|BAF95850.1| putative chloroplast chlorophyll a/b binding pro... 222 4e-56 ref|XP_002285646.1| PREDICTED: chlorophyll a-b binding protein 4... 222 4e-56 ref|XP_002455902.1| hypothetical protein SORBIDRAFT_03g027040 [S... 222 5e-56 ref|XP_002455901.1| hypothetical protein SORBIDRAFT_03g027030 [S... 222 5e-56 gb|ACG30091.1| chlorophyll a-b binding protein 2 [Zea mays] 221 1e-55 ref|NP_001142284.1| uncharacterized protein LOC100274453 [Zea ma... 221 1e-55 ref|XP_004145734.1| PREDICTED: chlorophyll a-b binding protein, ... 220 2e-55 ref|XP_004234241.1| PREDICTED: uncharacterized protein LOC101245... 219 4e-55 ref|XP_004234063.1| PREDICTED: chlorophyll a-b binding protein 3... 219 4e-55 ref|XP_004234062.1| PREDICTED: chlorophyll a-b binding protein 3... 219 4e-55 ref|XP_004234058.1| PREDICTED: chlorophyll a-b binding protein 3... 219 4e-55 gb|ABF17940.1| putative chloroplast chlorophyll a/b-binding prot... 219 4e-55 gb|AGJ50622.1| chlorophyll a/b binding protein [Salicornia brach... 218 7e-55 sp|P12329.1|CB21_MAIZE RecName: Full=Chlorophyll a-b binding pro... 218 9e-55 tpg|DAA58853.1| TPA: hypothetical protein ZEAMMB73_924562 [Zea m... 218 9e-55 tpg|DAA58850.1| TPA: chlorophyll a-b binding protein 48, Precurs... 218 9e-55 ref|NP_001148439.1| chlorophyll a-b binding protein 2 [Zea mays]... 218 9e-55 gb|AFV34722.1| light harvesting chlorophyll a/b-binding protein ... 216 2e-54 ref|NP_001147639.1| chlorophyll a-b binding protein 1, chloropla... 216 3e-54 >gb|ABD38707.1| chloroplast chlorophyll a/b binding protein [Pachysandra terminalis] Length = 267 Score = 223 bits (569), Expect = 2e-56 Identities = 101/108 (93%), Positives = 105/108 (97%) Frame = -3 Query: 326 TMRKTGGRPKPAVSGSPWYGADRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETF 147 +MRKTGGRPKP SGSPWYG DRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETF Sbjct: 34 SMRKTGGRPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETF 93 Query: 146 AKNRELEVIHCRWAMMGALGCVFPELLSRNGVKFGEAVWFKAGSQIFS 3 AKNRELEVIHCRWAM+GALGCVFPELL+RNGVKFGEAVWFKAG+QIFS Sbjct: 94 AKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFS 141 >dbj|BAF95850.1| putative chloroplast chlorophyll a/b binding protein [Vitis hybrid cultivar] Length = 234 Score = 222 bits (566), Expect = 4e-56 Identities = 101/108 (93%), Positives = 104/108 (96%) Frame = -3 Query: 326 TMRKTGGRPKPAVSGSPWYGADRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETF 147 TMRKTGGR KP SGSPWYG DRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETF Sbjct: 32 TMRKTGGRAKPVSSGSPWYGTDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETF 91 Query: 146 AKNRELEVIHCRWAMMGALGCVFPELLSRNGVKFGEAVWFKAGSQIFS 3 AKNRELEVIHCRWAM+GALGCVFPELL+RNGVKFGEAVWFKAG+QIFS Sbjct: 92 AKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFS 139 >ref|XP_002285646.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic [Vitis vinifera] gi|147833686|emb|CAN73057.1| hypothetical protein VITISV_007597 [Vitis vinifera] Length = 267 Score = 222 bits (566), Expect = 4e-56 Identities = 101/108 (93%), Positives = 104/108 (96%) Frame = -3 Query: 326 TMRKTGGRPKPAVSGSPWYGADRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETF 147 TMRKTGGR KP SGSPWYG DRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETF Sbjct: 34 TMRKTGGRAKPVSSGSPWYGTDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETF 93 Query: 146 AKNRELEVIHCRWAMMGALGCVFPELLSRNGVKFGEAVWFKAGSQIFS 3 AKNRELEVIHCRWAM+GALGCVFPELL+RNGVKFGEAVWFKAG+QIFS Sbjct: 94 AKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFS 141 >ref|XP_002455902.1| hypothetical protein SORBIDRAFT_03g027040 [Sorghum bicolor] gi|241927877|gb|EES01022.1| hypothetical protein SORBIDRAFT_03g027040 [Sorghum bicolor] Length = 265 Score = 222 bits (565), Expect = 5e-56 Identities = 101/108 (93%), Positives = 104/108 (96%) Frame = -3 Query: 326 TMRKTGGRPKPAVSGSPWYGADRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETF 147 TMRKT +PKPA SGSPWYGADRV YLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETF Sbjct: 32 TMRKTAAKPKPAASGSPWYGADRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETF 91 Query: 146 AKNRELEVIHCRWAMMGALGCVFPELLSRNGVKFGEAVWFKAGSQIFS 3 AKNRELEVIHCRWAM+GALGCVFPELL+RNGVKFGEAVWFKAGSQIFS Sbjct: 92 AKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFS 139 >ref|XP_002455901.1| hypothetical protein SORBIDRAFT_03g027030 [Sorghum bicolor] gi|241927876|gb|EES01021.1| hypothetical protein SORBIDRAFT_03g027030 [Sorghum bicolor] Length = 266 Score = 222 bits (565), Expect = 5e-56 Identities = 101/108 (93%), Positives = 104/108 (96%) Frame = -3 Query: 326 TMRKTGGRPKPAVSGSPWYGADRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETF 147 TMRKT +PKPA SGSPWYGADRV YLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETF Sbjct: 33 TMRKTAAKPKPAASGSPWYGADRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETF 92 Query: 146 AKNRELEVIHCRWAMMGALGCVFPELLSRNGVKFGEAVWFKAGSQIFS 3 AKNRELEVIHCRWAM+GALGCVFPELL+RNGVKFGEAVWFKAGSQIFS Sbjct: 93 AKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFS 140 >gb|ACG30091.1| chlorophyll a-b binding protein 2 [Zea mays] Length = 241 Score = 221 bits (562), Expect = 1e-55 Identities = 100/108 (92%), Positives = 104/108 (96%) Frame = -3 Query: 326 TMRKTGGRPKPAVSGSPWYGADRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETF 147 TMRKT G+PKPA SGSPWYGADRV YLGP SG+PPSYLTGEFPGDYGWDTAGLSADPETF Sbjct: 31 TMRKTAGKPKPAASGSPWYGADRVLYLGPLSGQPPSYLTGEFPGDYGWDTAGLSADPETF 90 Query: 146 AKNRELEVIHCRWAMMGALGCVFPELLSRNGVKFGEAVWFKAGSQIFS 3 AKNRELEVIHCRWAM+GALGCVFPELL+RNGVKFGEAVWFKAGSQIFS Sbjct: 91 AKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFS 138 >ref|NP_001142284.1| uncharacterized protein LOC100274453 [Zea mays] gi|194708004|gb|ACF88086.1| unknown [Zea mays] gi|195613594|gb|ACG28627.1| chlorophyll a-b binding protein 2 [Zea mays] gi|413950532|gb|AFW83181.1| light harvesting chlorophyll a/b binding protein1 isoform 1 [Zea mays] gi|413950533|gb|AFW83182.1| light harvesting chlorophyll a/b binding protein1 isoform 2 [Zea mays] Length = 264 Score = 221 bits (562), Expect = 1e-55 Identities = 100/108 (92%), Positives = 104/108 (96%) Frame = -3 Query: 326 TMRKTGGRPKPAVSGSPWYGADRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETF 147 TMRKT G+PKPA SGSPWYGADRV YLGP SG+PPSYLTGEFPGDYGWDTAGLSADPETF Sbjct: 31 TMRKTAGKPKPAASGSPWYGADRVLYLGPLSGQPPSYLTGEFPGDYGWDTAGLSADPETF 90 Query: 146 AKNRELEVIHCRWAMMGALGCVFPELLSRNGVKFGEAVWFKAGSQIFS 3 AKNRELEVIHCRWAM+GALGCVFPELL+RNGVKFGEAVWFKAGSQIFS Sbjct: 91 AKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFS 138 >ref|XP_004145734.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like [Cucumis sativus] gi|449525484|ref|XP_004169747.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like [Cucumis sativus] Length = 267 Score = 220 bits (560), Expect = 2e-55 Identities = 101/108 (93%), Positives = 103/108 (95%) Frame = -3 Query: 326 TMRKTGGRPKPAVSGSPWYGADRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETF 147 TMRKT G+PKP SGSPWYG DRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETF Sbjct: 34 TMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETF 93 Query: 146 AKNRELEVIHCRWAMMGALGCVFPELLSRNGVKFGEAVWFKAGSQIFS 3 AKNRELEVIH RWAM+GALGCVFPELLSRNGVKFGEAVWFKAGSQIFS Sbjct: 94 AKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFS 141 >ref|XP_004234241.1| PREDICTED: uncharacterized protein LOC101245729 [Solanum lycopersicum] Length = 554 Score = 219 bits (557), Expect = 4e-55 Identities = 100/108 (92%), Positives = 103/108 (95%) Frame = -3 Query: 326 TMRKTGGRPKPAVSGSPWYGADRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETF 147 TMRKT +PKPA SGSPWYG DRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETF Sbjct: 34 TMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETF 93 Query: 146 AKNRELEVIHCRWAMMGALGCVFPELLSRNGVKFGEAVWFKAGSQIFS 3 AKNRELEVIHCRWAM+GALGCVFPELL+RNGVKFGEAVWFKAGSQIFS Sbjct: 94 AKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFS 141 Score = 215 bits (547), Expect = 6e-54 Identities = 99/108 (91%), Positives = 102/108 (94%) Frame = -3 Query: 326 TMRKTGGRPKPAVSGSPWYGADRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETF 147 TMRKT + KPA SGSPWYG DRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETF Sbjct: 321 TMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETF 380 Query: 146 AKNRELEVIHCRWAMMGALGCVFPELLSRNGVKFGEAVWFKAGSQIFS 3 AKNRELEVIHCRWAM+GALGCVFPELL+RNGVKFGEAVWFKAGSQIFS Sbjct: 381 AKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFS 428 >ref|XP_004234063.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like isoform 6 [Solanum lycopersicum] Length = 244 Score = 219 bits (557), Expect = 4e-55 Identities = 100/108 (92%), Positives = 103/108 (95%) Frame = -3 Query: 326 TMRKTGGRPKPAVSGSPWYGADRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETF 147 TMRKT +PKPA SGSPWYG DRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETF Sbjct: 34 TMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETF 93 Query: 146 AKNRELEVIHCRWAMMGALGCVFPELLSRNGVKFGEAVWFKAGSQIFS 3 AKNRELEVIHCRWAM+GALGCVFPELL+RNGVKFGEAVWFKAGSQIFS Sbjct: 94 AKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFS 141 >ref|XP_004234062.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like isoform 5 [Solanum lycopersicum] Length = 255 Score = 219 bits (557), Expect = 4e-55 Identities = 100/108 (92%), Positives = 103/108 (95%) Frame = -3 Query: 326 TMRKTGGRPKPAVSGSPWYGADRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETF 147 TMRKT +PKPA SGSPWYG DRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETF Sbjct: 34 TMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETF 93 Query: 146 AKNRELEVIHCRWAMMGALGCVFPELLSRNGVKFGEAVWFKAGSQIFS 3 AKNRELEVIHCRWAM+GALGCVFPELL+RNGVKFGEAVWFKAGSQIFS Sbjct: 94 AKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFS 141 >ref|XP_004234058.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like isoform 1 [Solanum lycopersicum] gi|460376546|ref|XP_004234059.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like isoform 2 [Solanum lycopersicum] gi|460376548|ref|XP_004234060.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like isoform 3 [Solanum lycopersicum] gi|460376550|ref|XP_004234061.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like isoform 4 [Solanum lycopersicum] Length = 267 Score = 219 bits (557), Expect = 4e-55 Identities = 100/108 (92%), Positives = 103/108 (95%) Frame = -3 Query: 326 TMRKTGGRPKPAVSGSPWYGADRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETF 147 TMRKT +PKPA SGSPWYG DRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETF Sbjct: 34 TMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETF 93 Query: 146 AKNRELEVIHCRWAMMGALGCVFPELLSRNGVKFGEAVWFKAGSQIFS 3 AKNRELEVIHCRWAM+GALGCVFPELL+RNGVKFGEAVWFKAGSQIFS Sbjct: 94 AKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFS 141 >gb|ABF17940.1| putative chloroplast chlorophyll a/b-binding protein [Carya cathayensis] Length = 267 Score = 219 bits (557), Expect = 4e-55 Identities = 100/108 (92%), Positives = 103/108 (95%) Frame = -3 Query: 326 TMRKTGGRPKPAVSGSPWYGADRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETF 147 TMRKT GRPKP SGSPWYG DRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETF Sbjct: 34 TMRKTAGRPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETF 93 Query: 146 AKNRELEVIHCRWAMMGALGCVFPELLSRNGVKFGEAVWFKAGSQIFS 3 AKNRELEVIH RWAM+GALGCVFPELL+RNGVKFGEAVWFKAG+QIFS Sbjct: 94 AKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFS 141 >gb|AGJ50622.1| chlorophyll a/b binding protein [Salicornia brachiata] Length = 267 Score = 218 bits (555), Expect = 7e-55 Identities = 99/108 (91%), Positives = 102/108 (94%) Frame = -3 Query: 326 TMRKTGGRPKPAVSGSPWYGADRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETF 147 TMRKT G+PK SGSPWYG DRVKYLGPFSGEPPSYLTGE PGDYGWDTAGLSADPETF Sbjct: 34 TMRKTAGKPKQVASGSPWYGPDRVKYLGPFSGEPPSYLTGELPGDYGWDTAGLSADPETF 93 Query: 146 AKNRELEVIHCRWAMMGALGCVFPELLSRNGVKFGEAVWFKAGSQIFS 3 AKNRELEVIHCRWAM+GALGCVFPELL+RNGVKFGEAVWFKAGSQIFS Sbjct: 94 AKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFS 141 >sp|P12329.1|CB21_MAIZE RecName: Full=Chlorophyll a-b binding protein 1, chloroplastic; AltName: Full=LHCII type I CAB-1; Short=LHCP; Flags: Precursor gi|22224|emb|CAA32900.1| unnamed protein product [Zea mays] gi|194699340|gb|ACF83754.1| unknown [Zea mays] gi|195607416|gb|ACG25538.1| chlorophyll a-b binding protein 2 [Zea mays] gi|195613460|gb|ACG28560.1| chlorophyll a-b binding protein 2 [Zea mays] gi|414886622|tpg|DAA62636.1| TPA: light harvesting chlorophyll a/b binding protein2 [Zea mays] Length = 262 Score = 218 bits (554), Expect = 9e-55 Identities = 101/108 (93%), Positives = 103/108 (95%) Frame = -3 Query: 326 TMRKTGGRPKPAVSGSPWYGADRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETF 147 TMRKT G+PK A SGSPWYG DRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETF Sbjct: 29 TMRKTVGKPKVAASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETF 88 Query: 146 AKNRELEVIHCRWAMMGALGCVFPELLSRNGVKFGEAVWFKAGSQIFS 3 AKNRELEVIH RWAM+GALGCVFPELLSRNGVKFGEAVWFKAGSQIFS Sbjct: 89 AKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFS 136 >tpg|DAA58853.1| TPA: hypothetical protein ZEAMMB73_924562 [Zea mays] Length = 259 Score = 218 bits (554), Expect = 9e-55 Identities = 99/108 (91%), Positives = 102/108 (94%) Frame = -3 Query: 326 TMRKTGGRPKPAVSGSPWYGADRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETF 147 TMRKT +PKPA SGSPWYGADRV YLGP SG PPSYLTGEFPGDYGWDTAGLSADPETF Sbjct: 26 TMRKTAAKPKPAASGSPWYGADRVLYLGPLSGSPPSYLTGEFPGDYGWDTAGLSADPETF 85 Query: 146 AKNRELEVIHCRWAMMGALGCVFPELLSRNGVKFGEAVWFKAGSQIFS 3 AKNRELEVIHCRWAM+GALGCVFPELL+RNGVKFGEAVWFKAGSQIFS Sbjct: 86 AKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFS 133 >tpg|DAA58850.1| TPA: chlorophyll a-b binding protein 48, Precursor [Zea mays] Length = 264 Score = 218 bits (554), Expect = 9e-55 Identities = 99/108 (91%), Positives = 102/108 (94%) Frame = -3 Query: 326 TMRKTGGRPKPAVSGSPWYGADRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETF 147 TMRKT +PKPA SGSPWYGADRV YLGP SG PPSYLTGEFPGDYGWDTAGLSADPETF Sbjct: 31 TMRKTAAKPKPAASGSPWYGADRVLYLGPLSGSPPSYLTGEFPGDYGWDTAGLSADPETF 90 Query: 146 AKNRELEVIHCRWAMMGALGCVFPELLSRNGVKFGEAVWFKAGSQIFS 3 AKNRELEVIHCRWAM+GALGCVFPELL+RNGVKFGEAVWFKAGSQIFS Sbjct: 91 AKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFS 138 >ref|NP_001148439.1| chlorophyll a-b binding protein 2 [Zea mays] gi|195619284|gb|ACG31472.1| chlorophyll a-b binding protein 2 [Zea mays] gi|414881723|tpg|DAA58854.1| TPA: chlorophyll a-b binding protein 2 [Zea mays] Length = 264 Score = 218 bits (554), Expect = 9e-55 Identities = 99/108 (91%), Positives = 102/108 (94%) Frame = -3 Query: 326 TMRKTGGRPKPAVSGSPWYGADRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETF 147 TMRKT +PKPA SGSPWYGADRV YLGP SG PPSYLTGEFPGDYGWDTAGLSADPETF Sbjct: 31 TMRKTAAKPKPAASGSPWYGADRVLYLGPLSGSPPSYLTGEFPGDYGWDTAGLSADPETF 90 Query: 146 AKNRELEVIHCRWAMMGALGCVFPELLSRNGVKFGEAVWFKAGSQIFS 3 AKNRELEVIHCRWAM+GALGCVFPELL+RNGVKFGEAVWFKAGSQIFS Sbjct: 91 AKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFS 138 >gb|AFV34722.1| light harvesting chlorophyll a/b-binding protein 1-1 [Dendrocalamus latiflorus] Length = 265 Score = 216 bits (551), Expect = 2e-54 Identities = 101/108 (93%), Positives = 103/108 (95%) Frame = -3 Query: 326 TMRKTGGRPKPAVSGSPWYGADRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETF 147 TMRKTG +PKPA SGSPWYG DRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSADPETF Sbjct: 33 TMRKTGAKPKPA-SGSPWYGPDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETF 91 Query: 146 AKNRELEVIHCRWAMMGALGCVFPELLSRNGVKFGEAVWFKAGSQIFS 3 AKNRELEVIHCRWAM+GALGCVFPELLSRNGVKFGEAVWFKAGSQIFS Sbjct: 92 AKNRELEVIHCRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFS 139 >ref|NP_001147639.1| chlorophyll a-b binding protein 1, chloroplastic precursor [Zea mays] gi|195612774|gb|ACG28217.1| chlorophyll a-b binding protein 2 [Zea mays] Length = 262 Score = 216 bits (550), Expect = 3e-54 Identities = 100/108 (92%), Positives = 103/108 (95%) Frame = -3 Query: 326 TMRKTGGRPKPAVSGSPWYGADRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETF 147 TMRKT G+PK A SGSPWYG DRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADP+TF Sbjct: 29 TMRKTVGKPKVAASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPKTF 88 Query: 146 AKNRELEVIHCRWAMMGALGCVFPELLSRNGVKFGEAVWFKAGSQIFS 3 AKNRELEVIH RWAM+GALGCVFPELLSRNGVKFGEAVWFKAGSQIFS Sbjct: 89 AKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFS 136