BLASTX nr result
ID: Zanthoxylum22_contig00043485
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00043485 (290 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006435633.1| hypothetical protein CICLE_v10032034mg [Citr... 64 6e-08 ref|XP_008233653.1| PREDICTED: putative DNA-binding protein ESCA... 62 1e-07 ref|XP_007218339.1| hypothetical protein PRUPE_ppa008610mg [Prun... 62 1e-07 ref|XP_007009270.1| AT-hook protein of GA feedback 2 [Theobroma ... 62 2e-07 ref|XP_010658536.1| PREDICTED: putative DNA-binding protein ESCA... 59 1e-06 emb|CBI31637.3| unnamed protein product [Vitis vinifera] 59 1e-06 emb|CAN75757.1| hypothetical protein VITISV_028561 [Vitis vinifera] 59 1e-06 ref|XP_002524209.1| ESC, putative [Ricinus communis] gi|22353648... 59 2e-06 ref|XP_011033055.1| PREDICTED: putative DNA-binding protein ESCA... 57 5e-06 ref|XP_002312113.2| hypothetical protein POPTR_0008s05890g [Popu... 57 5e-06 ref|XP_009607803.1| PREDICTED: putative DNA-binding protein ESCA... 57 7e-06 gb|KNA11599.1| hypothetical protein SOVF_133730 [Spinacia oleracea] 56 9e-06 ref|XP_009774038.1| PREDICTED: putative DNA-binding protein ESCA... 56 9e-06 >ref|XP_006435633.1| hypothetical protein CICLE_v10032034mg [Citrus clementina] gi|568866102|ref|XP_006486403.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Citrus sinensis] gi|557537829|gb|ESR48873.1| hypothetical protein CICLE_v10032034mg [Citrus clementina] Length = 338 Score = 63.5 bits (153), Expect = 6e-08 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = -1 Query: 233 TTSMSIYNLPQNLLPNGEMPPDVFWGQPPRPPSFN 129 T M IYNLP NL+PNG+MP DVFWG PPRPP FN Sbjct: 304 TMPMPIYNLPPNLMPNGQMPHDVFWGPPPRPPPFN 338 >ref|XP_008233653.1| PREDICTED: putative DNA-binding protein ESCAROLA [Prunus mume] Length = 326 Score = 62.4 bits (150), Expect = 1e-07 Identities = 27/33 (81%), Positives = 30/33 (90%), Gaps = 1/33 (3%) Frame = -1 Query: 233 TTSMSIYNLPQNLLPNGEMPPDVFWG-QPPRPP 138 T+SM+IYNLP NLLPNG+MPPDVFWG PPRPP Sbjct: 290 TSSMAIYNLPPNLLPNGQMPPDVFWGPPPPRPP 322 >ref|XP_007218339.1| hypothetical protein PRUPE_ppa008610mg [Prunus persica] gi|462414801|gb|EMJ19538.1| hypothetical protein PRUPE_ppa008610mg [Prunus persica] Length = 325 Score = 62.4 bits (150), Expect = 1e-07 Identities = 27/33 (81%), Positives = 30/33 (90%), Gaps = 1/33 (3%) Frame = -1 Query: 233 TTSMSIYNLPQNLLPNGEMPPDVFWG-QPPRPP 138 T+SM+IYNLP NLLPNG+MPPDVFWG PPRPP Sbjct: 289 TSSMAIYNLPPNLLPNGQMPPDVFWGPPPPRPP 321 >ref|XP_007009270.1| AT-hook protein of GA feedback 2 [Theobroma cacao] gi|508726183|gb|EOY18080.1| AT-hook protein of GA feedback 2 [Theobroma cacao] Length = 339 Score = 61.6 bits (148), Expect = 2e-07 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -1 Query: 227 SMSIYNLPQNLLPNGEMPPDVFWGQPPRPP 138 S+ +YNLP NLLPNG+MPPDVFWG PPRPP Sbjct: 307 SIPLYNLPPNLLPNGQMPPDVFWGPPPRPP 336 >ref|XP_010658536.1| PREDICTED: putative DNA-binding protein ESCAROLA [Vitis vinifera] Length = 327 Score = 59.3 bits (142), Expect = 1e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -1 Query: 230 TSMSIYNLPQNLLPNGEMPPDVFWGQPPRPPSF 132 +SM IYNLP NLLPNG+MP DVFW PPRPP + Sbjct: 295 SSMPIYNLPPNLLPNGQMPHDVFWAPPPRPPPY 327 >emb|CBI31637.3| unnamed protein product [Vitis vinifera] Length = 300 Score = 59.3 bits (142), Expect = 1e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -1 Query: 230 TSMSIYNLPQNLLPNGEMPPDVFWGQPPRPPSF 132 +SM IYNLP NLLPNG+MP DVFW PPRPP + Sbjct: 268 SSMPIYNLPPNLLPNGQMPHDVFWAPPPRPPPY 300 >emb|CAN75757.1| hypothetical protein VITISV_028561 [Vitis vinifera] Length = 293 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = -1 Query: 230 TSMSIYNLPQNLLPNGEMPPDVFWGQPPRPPSF 132 +SM IYN+P NLLPNG+MP DVFW PPRPP + Sbjct: 261 SSMPIYNJPPNLLPNGQMPHDVFWAPPPRPPPY 293 >ref|XP_002524209.1| ESC, putative [Ricinus communis] gi|223536486|gb|EEF38133.1| ESC, putative [Ricinus communis] Length = 342 Score = 58.5 bits (140), Expect = 2e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -1 Query: 227 SMSIYNLPQNLLPNGEMPPDVFWGQPPRPP 138 SM +YNLP NLLPNG+MP +VFWG PPRPP Sbjct: 310 SMPVYNLPPNLLPNGQMPHEVFWGPPPRPP 339 >ref|XP_011033055.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica] gi|743780528|ref|XP_011033132.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica] Length = 334 Score = 57.0 bits (136), Expect = 5e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -1 Query: 227 SMSIYNLPQNLLPNGEMPPDVFWGQPPRPP 138 S+ ++NLP NLLPNG+MP DVFWG PPRPP Sbjct: 302 SIPVFNLPPNLLPNGQMPHDVFWGPPPRPP 331 >ref|XP_002312113.2| hypothetical protein POPTR_0008s05890g [Populus trichocarpa] gi|550332516|gb|EEE89480.2| hypothetical protein POPTR_0008s05890g [Populus trichocarpa] Length = 336 Score = 57.0 bits (136), Expect = 5e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -1 Query: 227 SMSIYNLPQNLLPNGEMPPDVFWGQPPRPP 138 S+ ++NLP NLLPNG+MP DVFWG PPRPP Sbjct: 304 SIPVFNLPPNLLPNGQMPHDVFWGPPPRPP 333 >ref|XP_009607803.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana tomentosiformis] Length = 319 Score = 56.6 bits (135), Expect = 7e-06 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -1 Query: 230 TSMSIYNLPQNLLPNGEMPPDVFWGQPPRPP 138 +SMS+YN+P N+LPNG+MP DVFW PPRPP Sbjct: 286 SSMSMYNMPTNVLPNGQMPHDVFWTPPPRPP 316 >gb|KNA11599.1| hypothetical protein SOVF_133730 [Spinacia oleracea] Length = 332 Score = 56.2 bits (134), Expect = 9e-06 Identities = 22/29 (75%), Positives = 25/29 (86%) Frame = -1 Query: 224 MSIYNLPQNLLPNGEMPPDVFWGQPPRPP 138 M I+NLP NLLPNG+MP D+FWG PPRPP Sbjct: 301 MPIFNLPPNLLPNGQMPHDMFWGPPPRPP 329 >ref|XP_009774038.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana sylvestris] Length = 323 Score = 56.2 bits (134), Expect = 9e-06 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = -1 Query: 230 TSMSIYNLPQNLLPNGEMPPDVFWGQPPRPP 138 +SM +YNLP N+LPNG+MP DVFW PPRPP Sbjct: 290 SSMPMYNLPTNVLPNGQMPHDVFWSPPPRPP 320