BLASTX nr result
ID: Zanthoxylum22_contig00043474
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00043474 (269 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006423135.1| hypothetical protein CICLE_v10030406mg [Citr... 92 7e-23 ref|XP_007041360.1| Pentatricopeptide repeat (PPR) superfamily p... 42 3e-08 ref|XP_007041365.1| Pentatricopeptide repeat superfamily protein... 42 3e-08 ref|XP_012069241.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-06 ref|XP_012436499.1| PREDICTED: pentatricopeptide repeat-containi... 43 3e-06 ref|XP_006297214.1| hypothetical protein CARUB_v10013223mg [Caps... 40 6e-06 >ref|XP_006423135.1| hypothetical protein CICLE_v10030406mg [Citrus clementina] gi|568851376|ref|XP_006479369.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial-like [Citrus sinensis] gi|557525069|gb|ESR36375.1| hypothetical protein CICLE_v10030406mg [Citrus clementina] Length = 645 Score = 91.7 bits (226), Expect(2) = 7e-23 Identities = 47/71 (66%), Positives = 52/71 (73%) Frame = -2 Query: 268 KTIIPPNQSHSHLLFSSIPQPKTTQQTQNFIPNTSTETPPEITNELLTHYINSSQWHFIK 89 KTII NQS+S LLFSS PQP+ TQQTQ FIPNTS PEIT+ELL YI+SSQWHFIK Sbjct: 16 KTIISTNQSNSCLLFSSTPQPRPTQQTQTFIPNTSGGNLPEITSELLNSYIHSSQWHFIK 75 Query: 88 HLHQNSLPLLL 56 L P L+ Sbjct: 76 QLAPKITPSLI 86 Score = 42.4 bits (98), Expect(2) = 7e-23 Identities = 18/26 (69%), Positives = 22/26 (84%) Frame = -1 Query: 83 APKLTPSLITTTLFNLHKTPELALQF 6 APK+TPSLIT+ L +LHK P+LA QF Sbjct: 78 APKITPSLITSALLDLHKNPDLAFQF 103 >ref|XP_007041360.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590682507|ref|XP_007041361.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590682510|ref|XP_007041362.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590682513|ref|XP_007041363.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590682516|ref|XP_007041364.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590682524|ref|XP_007041366.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705295|gb|EOX97191.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705296|gb|EOX97192.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705297|gb|EOX97193.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705298|gb|EOX97194.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705299|gb|EOX97195.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705301|gb|EOX97197.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] Length = 650 Score = 42.4 bits (98), Expect(2) = 3e-08 Identities = 19/24 (79%), Positives = 21/24 (87%) Frame = -1 Query: 74 LTPSLITTTLFNLHKTPELALQFT 3 L PS+I+T L NLHKTPELALQFT Sbjct: 86 LNPSVISTVLLNLHKTPELALQFT 109 Score = 42.0 bits (97), Expect(2) = 3e-08 Identities = 27/71 (38%), Positives = 36/71 (50%) Frame = -2 Query: 268 KTIIPPNQSHSHLLFSSIPQPKTTQQTQNFIPNTSTETPPEITNELLTHYINSSQWHFIK 89 KT+IP HS L SS Q T+ Q+Q +I+ ELL + SSQWHFIK Sbjct: 33 KTVIP----HSSALCSSTSQLVTSDQSQT--------ASSQISPELLIESVRSSQWHFIK 80 Query: 88 HLHQNSLPLLL 56 H + P ++ Sbjct: 81 HQSSDLNPSVI 91 >ref|XP_007041365.1| Pentatricopeptide repeat superfamily protein isoform 6 [Theobroma cacao] gi|508705300|gb|EOX97196.1| Pentatricopeptide repeat superfamily protein isoform 6 [Theobroma cacao] Length = 494 Score = 42.4 bits (98), Expect(2) = 3e-08 Identities = 19/24 (79%), Positives = 21/24 (87%) Frame = -1 Query: 74 LTPSLITTTLFNLHKTPELALQFT 3 L PS+I+T L NLHKTPELALQFT Sbjct: 86 LNPSVISTVLLNLHKTPELALQFT 109 Score = 42.0 bits (97), Expect(2) = 3e-08 Identities = 27/71 (38%), Positives = 36/71 (50%) Frame = -2 Query: 268 KTIIPPNQSHSHLLFSSIPQPKTTQQTQNFIPNTSTETPPEITNELLTHYINSSQWHFIK 89 KT+IP HS L SS Q T+ Q+Q +I+ ELL + SSQWHFIK Sbjct: 33 KTVIP----HSSALCSSTSQLVTSDQSQT--------ASSQISPELLIESVRSSQWHFIK 80 Query: 88 HLHQNSLPLLL 56 H + P ++ Sbjct: 81 HQSSDLNPSVI 91 >ref|XP_012069241.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial [Jatropha curcas] gi|643740596|gb|KDP46186.1| hypothetical protein JCGZ_10026 [Jatropha curcas] Length = 649 Score = 58.5 bits (140), Expect = 2e-06 Identities = 34/81 (41%), Positives = 44/81 (54%), Gaps = 2/81 (2%) Frame = -2 Query: 262 IIPPNQSHSHLLFSSIPQPKTTQ-QTQNFIPNTSTETPPEITNELLTHYINSSQWHFIKH 86 + P Q H + L SS P P T QT+ N ST +PP T++ L I SS+WHFIKH Sbjct: 22 VTAPYQLHCYSLLSSTPSPNTDHPQTRKIYANFSTTSPPVTTHQELLKSIQSSRWHFIKH 81 Query: 85 LHQNSLPLLLQ-QLFSIFTKP 26 L + P L+ L S+ KP Sbjct: 82 LAPSLTPSLVSATLLSLQKKP 102 >ref|XP_012436499.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial [Gossypium raimondii] gi|763780763|gb|KJB47834.1| hypothetical protein B456_008G044300 [Gossypium raimondii] Length = 631 Score = 43.1 bits (100), Expect(2) = 3e-06 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = -1 Query: 83 APKLTPSLITTTLFNLHKTPELALQFT 3 +P L SLI+T L NLHKTPELALQFT Sbjct: 64 SPNLDSSLISTVLLNLHKTPELALQFT 90 Score = 34.7 bits (78), Expect(2) = 3e-06 Identities = 21/56 (37%), Positives = 32/56 (57%) Frame = -2 Query: 241 HSHLLFSSIPQPKTTQQTQNFIPNTSTETPPEITNELLTHYINSSQWHFIKHLHQN 74 H LFS++ T+ ++Q+ P++ EI+ ++L SSQWHFIKHL N Sbjct: 20 HQRSLFSALSS-STSDRSQS--PSS------EISPDVLVESARSSQWHFIKHLSPN 66 >ref|XP_006297214.1| hypothetical protein CARUB_v10013223mg [Capsella rubella] gi|482565923|gb|EOA30112.1| hypothetical protein CARUB_v10013223mg [Capsella rubella] Length = 623 Score = 39.7 bits (91), Expect(2) = 6e-06 Identities = 23/62 (37%), Positives = 31/62 (50%) Frame = -2 Query: 241 HSHLLFSSIPQPKTTQQTQNFIPNTSTETPPEITNELLTHYINSSQWHFIKHLHQNSLPL 62 H +FS P T + + T E PP IT+++L I SSQWH ++HL P Sbjct: 12 HRISIFSGTGSPLTAVRLSSLA--TDLELPP-ITSDILLDSIKSSQWHIVEHLSDKFTPS 68 Query: 61 LL 56 LL Sbjct: 69 LL 70 Score = 37.0 bits (84), Expect(2) = 6e-06 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -1 Query: 77 KLTPSLITTTLFNLHKTPELALQF 6 K TPSL++TTL NL KTP+LAL F Sbjct: 64 KFTPSLLSTTLLNLVKTPDLALGF 87