BLASTX nr result
ID: Zanthoxylum22_contig00043279
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00043279 (304 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO68917.1| hypothetical protein CISIN_1g038194mg [Citrus sin... 72 2e-10 ref|XP_006435774.1| hypothetical protein CICLE_v10033578mg [Citr... 72 2e-10 >gb|KDO68917.1| hypothetical protein CISIN_1g038194mg [Citrus sinensis] Length = 349 Score = 71.6 bits (174), Expect = 2e-10 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -3 Query: 302 SPSIWPLMNDEDYPSSCFWDYTDPFLFDPFFST 204 SPSIWPL N+EDYP +C WDYTDPFLFDPFFST Sbjct: 317 SPSIWPLTNEEDYPPTCLWDYTDPFLFDPFFST 349 >ref|XP_006435774.1| hypothetical protein CICLE_v10033578mg [Citrus clementina] gi|568866367|ref|XP_006486528.1| PREDICTED: ethylene-responsive transcription factor ABI4-like [Citrus sinensis] gi|557537970|gb|ESR49014.1| hypothetical protein CICLE_v10033578mg [Citrus clementina] Length = 349 Score = 71.6 bits (174), Expect = 2e-10 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -3 Query: 302 SPSIWPLMNDEDYPSSCFWDYTDPFLFDPFFST 204 SPSIWPL N+EDYP +C WDYTDPFLFDPFFST Sbjct: 317 SPSIWPLTNEEDYPPTCLWDYTDPFLFDPFFST 349