BLASTX nr result
ID: Zanthoxylum22_contig00043054
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00043054 (365 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO58807.1| hypothetical protein CISIN_1g037622mg [Citrus sin... 96 8e-18 ref|XP_006432648.1| hypothetical protein CICLE_v10000735mg [Citr... 96 1e-17 ref|XP_011028085.1| PREDICTED: 4-coumarate--CoA ligase-like 6 [P... 91 3e-16 gb|AGO89326.1| Ca4CL9 [Salix arbutifolia] 89 1e-15 ref|XP_007040775.1| Acyl:coa ligase [Theobroma cacao] gi|5087780... 89 1e-15 ref|XP_002304364.1| 4-coumarate--CoA ligase family protein [Popu... 88 2e-15 ref|XP_002304363.1| hypothetical protein POPTR_0003s09880g [Popu... 88 2e-15 ref|XP_010261634.1| PREDICTED: 4-coumarate--CoA ligase-like 6 [N... 86 1e-14 ref|XP_004144410.1| PREDICTED: 4-coumarate--CoA ligase-like 6 [C... 85 2e-14 ref|XP_002270360.1| PREDICTED: 4-coumarate--CoA ligase-like 6 is... 84 5e-14 ref|XP_012066489.1| PREDICTED: 4-coumarate--CoA ligase-like 6 is... 83 9e-14 ref|XP_012066481.1| PREDICTED: 4-coumarate--CoA ligase-like 6 is... 83 9e-14 gb|KHG01780.1| 4-coumarate--CoA ligase-like 6 [Gossypium arboreum] 83 9e-14 ref|XP_010054104.1| PREDICTED: 4-coumarate--CoA ligase-like 6 is... 83 9e-14 ref|XP_010054103.1| PREDICTED: 4-coumarate--CoA ligase-like 6 is... 83 9e-14 gb|KDP46675.1| hypothetical protein JCGZ_12199 [Jatropha curcas] 83 9e-14 gb|KCW78480.1| hypothetical protein EUGRSUZ_D02624 [Eucalyptus g... 83 9e-14 gb|KCW78479.1| hypothetical protein EUGRSUZ_D02624 [Eucalyptus g... 83 9e-14 gb|KCW78478.1| hypothetical protein EUGRSUZ_D02624 [Eucalyptus g... 83 9e-14 ref|XP_012475610.1| PREDICTED: 4-coumarate--CoA ligase-like 6 is... 82 2e-13 >gb|KDO58807.1| hypothetical protein CISIN_1g037622mg [Citrus sinensis] Length = 560 Score = 96.3 bits (238), Expect = 8e-18 Identities = 48/59 (81%), Positives = 55/59 (93%) Frame = -2 Query: 364 FVVKCPGSTLTEAAVINYLAQQVAPYKKVRKVVFTKSIPKSAAGKILRRELRNYITCKL 188 FVV+ GSTLTEAAVI+YLAQ+VAPYKKVR+VVFTKSIPKSAAGK+LRRELR ++T KL Sbjct: 502 FVVRRDGSTLTEAAVIDYLAQRVAPYKKVRRVVFTKSIPKSAAGKVLRRELRKFLTSKL 560 >ref|XP_006432648.1| hypothetical protein CICLE_v10000735mg [Citrus clementina] gi|568834716|ref|XP_006471457.1| PREDICTED: 4-coumarate--CoA ligase-like 6-like [Citrus sinensis] gi|557534770|gb|ESR45888.1| hypothetical protein CICLE_v10000735mg [Citrus clementina] Length = 561 Score = 95.5 bits (236), Expect = 1e-17 Identities = 47/59 (79%), Positives = 55/59 (93%) Frame = -2 Query: 364 FVVKCPGSTLTEAAVINYLAQQVAPYKKVRKVVFTKSIPKSAAGKILRRELRNYITCKL 188 FVV+ GSTLTEAAVI+Y+AQ+VAPYKKVR+VVFTKSIPKSAAGK+LRRELR ++T KL Sbjct: 503 FVVRRDGSTLTEAAVIDYIAQRVAPYKKVRRVVFTKSIPKSAAGKVLRRELRKFLTSKL 561 >ref|XP_011028085.1| PREDICTED: 4-coumarate--CoA ligase-like 6 [Populus euphratica] Length = 554 Score = 90.9 bits (224), Expect = 3e-16 Identities = 45/59 (76%), Positives = 52/59 (88%) Frame = -2 Query: 364 FVVKCPGSTLTEAAVINYLAQQVAPYKKVRKVVFTKSIPKSAAGKILRRELRNYITCKL 188 FVVK GS LT+ A+INY+A+QVAPYKKVRKV+FT+SIPKSAAGKILRRELR +T KL Sbjct: 496 FVVKRQGSMLTQEAIINYVAEQVAPYKKVRKVIFTRSIPKSAAGKILRRELRRSLTSKL 554 >gb|AGO89326.1| Ca4CL9 [Salix arbutifolia] Length = 554 Score = 89.4 bits (220), Expect = 1e-15 Identities = 44/59 (74%), Positives = 52/59 (88%) Frame = -2 Query: 364 FVVKCPGSTLTEAAVINYLAQQVAPYKKVRKVVFTKSIPKSAAGKILRRELRNYITCKL 188 FVVK GS +T+ A+INY+A QVAPYKKVRKV+FT+SIPKSAAGKILRREL+N +T KL Sbjct: 496 FVVKRKGSMVTKEAIINYVADQVAPYKKVRKVIFTQSIPKSAAGKILRRELKNSLTSKL 554 >ref|XP_007040775.1| Acyl:coa ligase [Theobroma cacao] gi|508778020|gb|EOY25276.1| Acyl:coa ligase [Theobroma cacao] Length = 561 Score = 89.0 bits (219), Expect = 1e-15 Identities = 43/59 (72%), Positives = 54/59 (91%) Frame = -2 Query: 364 FVVKCPGSTLTEAAVINYLAQQVAPYKKVRKVVFTKSIPKSAAGKILRRELRNYITCKL 188 FVV+ GSTLT+ AV++++A+QVAPYKKVRKVVFTKSIPKSAAGK LRRELRN+++ +L Sbjct: 503 FVVRRQGSTLTQGAVMDFVAKQVAPYKKVRKVVFTKSIPKSAAGKTLRRELRNFLSSRL 561 >ref|XP_002304364.1| 4-coumarate--CoA ligase family protein [Populus trichocarpa] gi|222841796|gb|EEE79343.1| 4-coumarate--CoA ligase family protein [Populus trichocarpa] Length = 544 Score = 88.2 bits (217), Expect = 2e-15 Identities = 44/59 (74%), Positives = 52/59 (88%) Frame = -2 Query: 364 FVVKCPGSTLTEAAVINYLAQQVAPYKKVRKVVFTKSIPKSAAGKILRRELRNYITCKL 188 FVVK GS LT+ A+INY+A+QVAPYKKVRKV+FT+SIPKSAAGKILRREL+ +T KL Sbjct: 486 FVVKRQGSMLTQEAIINYVAEQVAPYKKVRKVIFTQSIPKSAAGKILRRELKCSLTSKL 544 >ref|XP_002304363.1| hypothetical protein POPTR_0003s09880g [Populus trichocarpa] gi|222841795|gb|EEE79342.1| hypothetical protein POPTR_0003s09880g [Populus trichocarpa] Length = 557 Score = 88.2 bits (217), Expect = 2e-15 Identities = 44/59 (74%), Positives = 52/59 (88%) Frame = -2 Query: 364 FVVKCPGSTLTEAAVINYLAQQVAPYKKVRKVVFTKSIPKSAAGKILRRELRNYITCKL 188 FVVK GS LT+ A+INY+A+QVAPYKKVRKV+FT+SIPKSAAGKILRREL+ +T KL Sbjct: 499 FVVKRQGSMLTQEAIINYVAEQVAPYKKVRKVIFTQSIPKSAAGKILRRELKCSLTSKL 557 >ref|XP_010261634.1| PREDICTED: 4-coumarate--CoA ligase-like 6 [Nelumbo nucifera] Length = 564 Score = 85.9 bits (211), Expect = 1e-14 Identities = 44/56 (78%), Positives = 49/56 (87%) Frame = -2 Query: 364 FVVKCPGSTLTEAAVINYLAQQVAPYKKVRKVVFTKSIPKSAAGKILRRELRNYIT 197 FVVK PGS L++A VI+Y+AQQVAPYKKVRKVVFT SIPKSAAGKILRR L N I+ Sbjct: 503 FVVKRPGSALSQADVIDYVAQQVAPYKKVRKVVFTSSIPKSAAGKILRRRLSNSIS 558 >ref|XP_004144410.1| PREDICTED: 4-coumarate--CoA ligase-like 6 [Cucumis sativus] gi|700203272|gb|KGN58405.1| hypothetical protein Csa_3G638510 [Cucumis sativus] Length = 577 Score = 84.7 bits (208), Expect = 2e-14 Identities = 40/54 (74%), Positives = 49/54 (90%) Frame = -2 Query: 364 FVVKCPGSTLTEAAVINYLAQQVAPYKKVRKVVFTKSIPKSAAGKILRRELRNY 203 FVVK PGS LT+ V++Y+AQQVAPYKKVRKV+FT+SIPKSAAGK+LRREL+ + Sbjct: 518 FVVKKPGSALTQKDVVDYVAQQVAPYKKVRKVIFTESIPKSAAGKVLRRELQKH 571 >ref|XP_002270360.1| PREDICTED: 4-coumarate--CoA ligase-like 6 isoform X1 [Vitis vinifera] gi|296083381|emb|CBI23270.3| unnamed protein product [Vitis vinifera] Length = 571 Score = 83.6 bits (205), Expect = 5e-14 Identities = 40/53 (75%), Positives = 48/53 (90%) Frame = -2 Query: 364 FVVKCPGSTLTEAAVINYLAQQVAPYKKVRKVVFTKSIPKSAAGKILRRELRN 206 FVVK PGS L++AA+INY+ +QVAPYKKVRKV+FT IPKSAAGKILRREL++ Sbjct: 512 FVVKRPGSALSQAAIINYVEKQVAPYKKVRKVIFTHPIPKSAAGKILRRELKH 564 >ref|XP_012066489.1| PREDICTED: 4-coumarate--CoA ligase-like 6 isoform X2 [Jatropha curcas] Length = 511 Score = 82.8 bits (203), Expect = 9e-14 Identities = 41/59 (69%), Positives = 49/59 (83%) Frame = -2 Query: 364 FVVKCPGSTLTEAAVINYLAQQVAPYKKVRKVVFTKSIPKSAAGKILRRELRNYITCKL 188 FVVK GS LTE A+ + +A QVAPYKKVRKV+F +SIPKSAAGKILRRELR Y++ +L Sbjct: 453 FVVKRQGSMLTERAIFDCVADQVAPYKKVRKVIFVQSIPKSAAGKILRRELRRYLSSRL 511 >ref|XP_012066481.1| PREDICTED: 4-coumarate--CoA ligase-like 6 isoform X1 [Jatropha curcas] Length = 559 Score = 82.8 bits (203), Expect = 9e-14 Identities = 41/59 (69%), Positives = 49/59 (83%) Frame = -2 Query: 364 FVVKCPGSTLTEAAVINYLAQQVAPYKKVRKVVFTKSIPKSAAGKILRRELRNYITCKL 188 FVVK GS LTE A+ + +A QVAPYKKVRKV+F +SIPKSAAGKILRRELR Y++ +L Sbjct: 501 FVVKRQGSMLTERAIFDCVADQVAPYKKVRKVIFVQSIPKSAAGKILRRELRRYLSSRL 559 >gb|KHG01780.1| 4-coumarate--CoA ligase-like 6 [Gossypium arboreum] Length = 534 Score = 82.8 bits (203), Expect = 9e-14 Identities = 40/59 (67%), Positives = 53/59 (89%) Frame = -2 Query: 364 FVVKCPGSTLTEAAVINYLAQQVAPYKKVRKVVFTKSIPKSAAGKILRRELRNYITCKL 188 FVV+ G TLT+ AVI+++A QVAPYKKVR+VVFT+SIPKSAAGKILR+EL+++I+ +L Sbjct: 476 FVVRRHGCTLTKGAVIDFVANQVAPYKKVRRVVFTESIPKSAAGKILRKELKSFISSRL 534 >ref|XP_010054104.1| PREDICTED: 4-coumarate--CoA ligase-like 6 isoform X2 [Eucalyptus grandis] Length = 552 Score = 82.8 bits (203), Expect = 9e-14 Identities = 42/59 (71%), Positives = 50/59 (84%) Frame = -2 Query: 364 FVVKCPGSTLTEAAVINYLAQQVAPYKKVRKVVFTKSIPKSAAGKILRRELRNYITCKL 188 FVV+ GS ++E AV++YLA QVAPYKKVRKVVFT SIPKSAAGKILRREL+ +T +L Sbjct: 494 FVVRRIGSNISEEAVMDYLAAQVAPYKKVRKVVFTSSIPKSAAGKILRRELKKSLTSRL 552 >ref|XP_010054103.1| PREDICTED: 4-coumarate--CoA ligase-like 6 isoform X1 [Eucalyptus grandis] Length = 558 Score = 82.8 bits (203), Expect = 9e-14 Identities = 42/59 (71%), Positives = 50/59 (84%) Frame = -2 Query: 364 FVVKCPGSTLTEAAVINYLAQQVAPYKKVRKVVFTKSIPKSAAGKILRRELRNYITCKL 188 FVV+ GS ++E AV++YLA QVAPYKKVRKVVFT SIPKSAAGKILRREL+ +T +L Sbjct: 500 FVVRRIGSNISEEAVMDYLAAQVAPYKKVRKVVFTSSIPKSAAGKILRRELKKSLTSRL 558 >gb|KDP46675.1| hypothetical protein JCGZ_12199 [Jatropha curcas] Length = 439 Score = 82.8 bits (203), Expect = 9e-14 Identities = 41/59 (69%), Positives = 49/59 (83%) Frame = -2 Query: 364 FVVKCPGSTLTEAAVINYLAQQVAPYKKVRKVVFTKSIPKSAAGKILRRELRNYITCKL 188 FVVK GS LTE A+ + +A QVAPYKKVRKV+F +SIPKSAAGKILRRELR Y++ +L Sbjct: 381 FVVKRQGSMLTERAIFDCVADQVAPYKKVRKVIFVQSIPKSAAGKILRRELRRYLSSRL 439 >gb|KCW78480.1| hypothetical protein EUGRSUZ_D02624 [Eucalyptus grandis] Length = 516 Score = 82.8 bits (203), Expect = 9e-14 Identities = 42/59 (71%), Positives = 50/59 (84%) Frame = -2 Query: 364 FVVKCPGSTLTEAAVINYLAQQVAPYKKVRKVVFTKSIPKSAAGKILRRELRNYITCKL 188 FVV+ GS ++E AV++YLA QVAPYKKVRKVVFT SIPKSAAGKILRREL+ +T +L Sbjct: 458 FVVRRIGSNISEEAVMDYLAAQVAPYKKVRKVVFTSSIPKSAAGKILRRELKKSLTSRL 516 >gb|KCW78479.1| hypothetical protein EUGRSUZ_D02624 [Eucalyptus grandis] Length = 524 Score = 82.8 bits (203), Expect = 9e-14 Identities = 42/59 (71%), Positives = 50/59 (84%) Frame = -2 Query: 364 FVVKCPGSTLTEAAVINYLAQQVAPYKKVRKVVFTKSIPKSAAGKILRRELRNYITCKL 188 FVV+ GS ++E AV++YLA QVAPYKKVRKVVFT SIPKSAAGKILRREL+ +T +L Sbjct: 466 FVVRRIGSNISEEAVMDYLAAQVAPYKKVRKVVFTSSIPKSAAGKILRRELKKSLTSRL 524 >gb|KCW78478.1| hypothetical protein EUGRSUZ_D02624 [Eucalyptus grandis] Length = 542 Score = 82.8 bits (203), Expect = 9e-14 Identities = 42/59 (71%), Positives = 50/59 (84%) Frame = -2 Query: 364 FVVKCPGSTLTEAAVINYLAQQVAPYKKVRKVVFTKSIPKSAAGKILRRELRNYITCKL 188 FVV+ GS ++E AV++YLA QVAPYKKVRKVVFT SIPKSAAGKILRREL+ +T +L Sbjct: 484 FVVRRIGSNISEEAVMDYLAAQVAPYKKVRKVVFTSSIPKSAAGKILRRELKKSLTSRL 542 >ref|XP_012475610.1| PREDICTED: 4-coumarate--CoA ligase-like 6 isoform X2 [Gossypium raimondii] gi|763757869|gb|KJB25200.1| hypothetical protein B456_004G180900 [Gossypium raimondii] Length = 559 Score = 82.0 bits (201), Expect = 2e-13 Identities = 40/59 (67%), Positives = 53/59 (89%) Frame = -2 Query: 364 FVVKCPGSTLTEAAVINYLAQQVAPYKKVRKVVFTKSIPKSAAGKILRRELRNYITCKL 188 FVV+ GSTLT+ AVI+++A QVAPYKKVR+VVFT+SIPKSAAGK LR+EL+++I+ +L Sbjct: 501 FVVRRHGSTLTKGAVIDFVANQVAPYKKVRRVVFTESIPKSAAGKNLRKELKSFISSRL 559