BLASTX nr result
ID: Zanthoxylum22_contig00042413
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00042413 (324 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGC78901.1| hypothetical protein (mitochondrion) [Vicia faba]... 80 4e-13 ref|YP_004842085.1| hypothetical protein BemaM_p038 [Beta macroc... 64 3e-08 >gb|AGC78901.1| hypothetical protein (mitochondrion) [Vicia faba] gi|442803279|gb|AGC79014.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 142 Score = 80.5 bits (197), Expect = 4e-13 Identities = 42/47 (89%), Positives = 44/47 (93%) Frame = -1 Query: 150 LFPLIEDSIYKRRSTSTGNTKVALTDTIYEKVRSSFFPAAIRFALKP 10 +F LIEDSIYKRRST G+TKVALTDTIYEKVRSSFFPAAIRFALKP Sbjct: 1 MFTLIEDSIYKRRST--GDTKVALTDTIYEKVRSSFFPAAIRFALKP 45 >ref|YP_004842085.1| hypothetical protein BemaM_p038 [Beta macrocarpa] gi|345500071|emb|CBX24887.1| hypothetical protein [Beta macrocarpa] Length = 160 Score = 64.3 bits (155), Expect = 3e-08 Identities = 35/52 (67%), Positives = 41/52 (78%), Gaps = 2/52 (3%) Frame = -1 Query: 156 GCLFPLIEDSIYKRRSTSTGNTKVALTDTIYEKVRSSFFPAA--IRFALKPY 7 GCLFPLIEDSIYKRRST +T++ALTDTIYEKVR F ++ FALKP+ Sbjct: 33 GCLFPLIEDSIYKRRSTE--DTQIALTDTIYEKVRQCNFLSSRHTLFALKPF 82