BLASTX nr result
ID: Zanthoxylum22_contig00042350
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00042350 (435 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535798.1| conserved hypothetical protein [Ricinus comm... 98 3e-18 gb|KJB09782.1| hypothetical protein B456_001G165500 [Gossypium r... 64 4e-08 >ref|XP_002535798.1| conserved hypothetical protein [Ricinus communis] gi|223521924|gb|EEF26587.1| conserved hypothetical protein [Ricinus communis] Length = 51 Score = 97.8 bits (242), Expect = 3e-18 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = +1 Query: 187 MGLPKENYNRSLSTTHKTTEIFDLAPEGNGNPPCPSPTYTRGAEDNERETKS 342 MGLPKEN NRSLSTTHKTTEIFDLAP+GN NPP PSPTYTRGAEDNERETKS Sbjct: 1 MGLPKENCNRSLSTTHKTTEIFDLAPKGN-NPPGPSPTYTRGAEDNERETKS 51 >gb|KJB09782.1| hypothetical protein B456_001G165500 [Gossypium raimondii] Length = 732 Score = 63.9 bits (154), Expect = 4e-08 Identities = 35/50 (70%), Positives = 35/50 (70%), Gaps = 6/50 (12%) Frame = -3 Query: 406 TNRIDSTDMIDGMGSL------CYDLVRTLSPFXXXXXXXXXLGKGRVDY 275 TNRIDSTDMIDGMGSL CYDLVRTLSPF LGKGRVDY Sbjct: 361 TNRIDSTDMIDGMGSLCYDVDVCYDLVRTLSPFRYLPLPLYRLGKGRVDY 410