BLASTX nr result
ID: Zanthoxylum22_contig00042313
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00042313 (295 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO47745.1| hypothetical protein CISIN_1g027039mg [Citrus sin... 65 2e-08 ref|XP_006447443.1| hypothetical protein CICLE_v10016548mg [Citr... 65 2e-08 >gb|KDO47745.1| hypothetical protein CISIN_1g027039mg [Citrus sinensis] Length = 229 Score = 65.1 bits (157), Expect = 2e-08 Identities = 33/40 (82%), Positives = 34/40 (85%) Frame = -1 Query: 295 REIKHIIGLFRRSRFVDAVNVTVNGSNMMRILMRRTRLSV 176 REIK I+ LFR SRFVDA NVTVNGSNM RILMRRTRL V Sbjct: 190 REIKQIVELFRTSRFVDAANVTVNGSNMTRILMRRTRLPV 229 >ref|XP_006447443.1| hypothetical protein CICLE_v10016548mg [Citrus clementina] gi|557550054|gb|ESR60683.1| hypothetical protein CICLE_v10016548mg [Citrus clementina] Length = 229 Score = 65.1 bits (157), Expect = 2e-08 Identities = 33/40 (82%), Positives = 34/40 (85%) Frame = -1 Query: 295 REIKHIIGLFRRSRFVDAVNVTVNGSNMMRILMRRTRLSV 176 REIK I+ LFR SRFVDA NVTVNGSNM RILMRRTRL V Sbjct: 190 REIKQIVELFRTSRFVDAANVTVNGSNMTRILMRRTRLPV 229