BLASTX nr result
ID: Zanthoxylum22_contig00042274
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00042274 (290 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO52174.1| hypothetical protein CISIN_1g017237mg [Citrus sin... 56 9e-06 ref|XP_006479394.1| PREDICTED: B3 domain-containing transcriptio... 56 9e-06 ref|XP_006423108.1| hypothetical protein CICLE_v10028501mg [Citr... 56 9e-06 >gb|KDO52174.1| hypothetical protein CISIN_1g017237mg [Citrus sinensis] Length = 375 Score = 56.2 bits (134), Expect = 9e-06 Identities = 33/44 (75%), Positives = 34/44 (77%), Gaps = 5/44 (11%) Frame = +1 Query: 172 EQQTAH-ETMSQP---YLPEVE-EDRSCIFYKLIVPSILQDKKL 288 EQQT H E MSQP YLPE E + RSCIFYKLIVPSIL DKKL Sbjct: 3 EQQTTHGEAMSQPLAPYLPEEENQKRSCIFYKLIVPSILHDKKL 46 >ref|XP_006479394.1| PREDICTED: B3 domain-containing transcription factor VRN1-like [Citrus sinensis] Length = 416 Score = 56.2 bits (134), Expect = 9e-06 Identities = 33/44 (75%), Positives = 34/44 (77%), Gaps = 5/44 (11%) Frame = +1 Query: 172 EQQTAH-ETMSQP---YLPEVE-EDRSCIFYKLIVPSILQDKKL 288 EQQT H E MSQP YLPE E + RSCIFYKLIVPSIL DKKL Sbjct: 3 EQQTTHGEAMSQPLAPYLPEEENQKRSCIFYKLIVPSILHDKKL 46 >ref|XP_006423108.1| hypothetical protein CICLE_v10028501mg [Citrus clementina] gi|557525042|gb|ESR36348.1| hypothetical protein CICLE_v10028501mg [Citrus clementina] Length = 426 Score = 56.2 bits (134), Expect = 9e-06 Identities = 33/44 (75%), Positives = 34/44 (77%), Gaps = 5/44 (11%) Frame = +1 Query: 172 EQQTAH-ETMSQP---YLPEVE-EDRSCIFYKLIVPSILQDKKL 288 EQQT H E MSQP YLPE E + RSCIFYKLIVPSIL DKKL Sbjct: 3 EQQTTHGEAMSQPLAPYLPEEENQKRSCIFYKLIVPSILHDKKL 46