BLASTX nr result
ID: Zanthoxylum22_contig00042067
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00042067 (338 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006451877.1| hypothetical protein CICLE_v10009812mg [Citr... 101 2e-19 >ref|XP_006451877.1| hypothetical protein CICLE_v10009812mg [Citrus clementina] gi|557555103|gb|ESR65117.1| hypothetical protein CICLE_v10009812mg [Citrus clementina] Length = 147 Score = 101 bits (252), Expect = 2e-19 Identities = 66/104 (63%), Positives = 73/104 (70%), Gaps = 8/104 (7%) Frame = -3 Query: 288 MANSATRIFLKNGKSFPHLLRSRLVGY---PSSIVNKDQLLILAQPL--PNPTHR---LY 133 MANSA RIFLKNGKSFP L SRLVG S++VNK QL +LAQPL NPT + LY Sbjct: 1 MANSAARIFLKNGKSFPQHLGSRLVGLLCPSSNVVNKHQLQLLAQPLISQNPTQQQQYLY 60 Query: 132 LQRPMLGDGFNFVLGKNHELPREAEVEAREGKMRLVTRYDEDED 1 LQRP LG+GFNFV + L E EAREGKMRLV+R DE ED Sbjct: 61 LQRPALGNGFNFV---DFVLGNE---EAREGKMRLVSRRDEAED 98