BLASTX nr result
ID: Zanthoxylum22_contig00042058
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00042058 (307 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EFA80887.1| cyclin domain-containing protein [Polysphondylium... 65 2e-08 ref|XP_003293438.1| hypothetical protein DICPUDRAFT_158283 [Dict... 65 3e-08 ref|XP_012750897.1| hypothetical protein SAMD00019534_095180 [Ac... 63 8e-08 ref|XP_004361246.1| cyclin domain-containing protein [Dictyostel... 63 1e-07 ref|XP_642568.1| cyclin domain-containing protein [Dictyostelium... 62 2e-07 ref|XP_012756835.1| hypothetical protein SAMD00019534_032480 [Ac... 61 3e-07 ref|XP_014012839.1| PREDICTED: cyclin-Y isoform X2 [Salmo salar] 57 5e-06 >gb|EFA80887.1| cyclin domain-containing protein [Polysphondylium pallidum PN500] Length = 392 Score = 65.5 bits (158), Expect = 2e-08 Identities = 31/82 (37%), Positives = 52/82 (63%) Frame = -1 Query: 277 PKFKPDVPALTQKMTHLNMNAMAATRRSSTSTAFVKDTIANPNRSELLVCIAHALYYHMS 98 P+FK + ++ Q H+ M + +STS+ ++K T++ P+ E+L C+A+AL YH+ Sbjct: 161 PQFKTPITSIPQ---HMRMEGFQRAKHNSTSSLYIKSTLSTPDNDEILRCMANALLYHIE 217 Query: 97 TGMQTKVKIHEDIFSEKLHPMT 32 G QT K H +IFSE+ +P+T Sbjct: 218 RGTQTPQK-HFEIFSEEKYPIT 238 >ref|XP_003293438.1| hypothetical protein DICPUDRAFT_158283 [Dictyostelium purpureum] gi|325076248|gb|EGC30051.1| hypothetical protein DICPUDRAFT_158283 [Dictyostelium purpureum] Length = 397 Score = 64.7 bits (156), Expect = 3e-08 Identities = 32/92 (34%), Positives = 54/92 (58%) Frame = -1 Query: 277 PKFKPDVPALTQKMTHLNMNAMAATRRSSTSTAFVKDTIANPNRSELLVCIAHALYYHMS 98 P+FK + ++ Q H+ M + +STS+ ++K T++ P+ E+L C+A+AL YH+ Sbjct: 139 PQFKTPITSIPQ---HMRMEGFQRVKHNSTSSLYIKSTLSTPDNDEILRCMANALLYHIE 195 Query: 97 TGMQTKVKIHEDIFSEKLHPMTREKPNFAKMP 2 G Q K E IFSE+ +P+T+ K + P Sbjct: 196 RGAQLPQKTVE-IFSEEKYPITKNKADLRTNP 226 >ref|XP_012750897.1| hypothetical protein SAMD00019534_095180 [Acytostelium subglobosum LB1] gi|735851529|dbj|GAM26343.1| hypothetical protein SAMD00019534_095180 [Acytostelium subglobosum LB1] Length = 421 Score = 63.2 bits (152), Expect = 8e-08 Identities = 33/92 (35%), Positives = 56/92 (60%) Frame = -1 Query: 277 PKFKPDVPALTQKMTHLNMNAMAATRRSSTSTAFVKDTIANPNRSELLVCIAHALYYHMS 98 P+FK + A+ Q H+ M + +STS+ ++K T++ P+ E+L C+A+AL YH+ Sbjct: 164 PQFKTPL-AIPQ---HMRMEGFQRAKHNSTSSLYIKSTLSTPDNDEILKCMANALLYHIE 219 Query: 97 TGMQTKVKIHEDIFSEKLHPMTREKPNFAKMP 2 G + K E IFSE+ +P+T+ K +F +P Sbjct: 220 RGTHSPQKTFE-IFSEEKYPITKGKLDFKMLP 250 >ref|XP_004361246.1| cyclin domain-containing protein [Dictyostelium fasciculatum] gi|328875030|gb|EGG23395.1| cyclin domain-containing protein [Dictyostelium fasciculatum] Length = 448 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/92 (31%), Positives = 52/92 (56%) Frame = -1 Query: 277 PKFKPDVPALTQKMTHLNMNAMAATRRSSTSTAFVKDTIANPNRSELLVCIAHALYYHMS 98 P+FK + ++ Q H+ M + +STS+ ++K T++ P+ E+L C++ AL YH+ Sbjct: 189 PQFKTPITSIPQ---HMRMEGFQRAKHNSTSSLYIKSTLSTPDNDEILRCMSCALLYHIE 245 Query: 97 TGMQTKVKIHEDIFSEKLHPMTREKPNFAKMP 2 G + DIFSE+ +P+T+ K +P Sbjct: 246 RGTHNPTQKTFDIFSEEKYPITKGKVEIKTIP 277 >ref|XP_642568.1| cyclin domain-containing protein [Dictyostelium discoideum AX4] gi|60470675|gb|EAL68651.1| cyclin domain-containing protein [Dictyostelium discoideum AX4] Length = 463 Score = 62.0 bits (149), Expect = 2e-07 Identities = 31/92 (33%), Positives = 53/92 (57%) Frame = -1 Query: 277 PKFKPDVPALTQKMTHLNMNAMAATRRSSTSTAFVKDTIANPNRSELLVCIAHALYYHMS 98 P+FK + ++ H+ M + +STS+ ++K T++ P+ E+L C+A+AL YH+ Sbjct: 205 PQFKTPITSIPH---HMRMEGFQRVKHNSTSSLYIKSTLSTPDNDEILRCMANALLYHIE 261 Query: 97 TGMQTKVKIHEDIFSEKLHPMTREKPNFAKMP 2 G Q K E IFSE+ +P+T+ K + P Sbjct: 262 RGSQFPQKTVE-IFSEEKYPITKNKIDLKSNP 292 >ref|XP_012756835.1| hypothetical protein SAMD00019534_032480 [Acytostelium subglobosum LB1] gi|735857467|dbj|GAM20073.1| hypothetical protein SAMD00019534_032480 [Acytostelium subglobosum LB1] Length = 396 Score = 61.2 bits (147), Expect = 3e-07 Identities = 33/92 (35%), Positives = 55/92 (59%) Frame = -1 Query: 277 PKFKPDVPALTQKMTHLNMNAMAATRRSSTSTAFVKDTIANPNRSELLVCIAHALYYHMS 98 P+FK A+ M + M + +STS+ ++K T++ P+ E+L C+A+AL YH+ Sbjct: 137 PQFKTPHSAIPPHMRNEGFQRM---KHNSTSSLYIKSTLSTPDNDEILRCMANALLYHIE 193 Query: 97 TGMQTKVKIHEDIFSEKLHPMTREKPNFAKMP 2 G+QT K +E IFSE+ +P+T+ K + P Sbjct: 194 RGIQTPQKNYE-IFSEEKYPITKGKLDLKTTP 224 >ref|XP_014012839.1| PREDICTED: cyclin-Y isoform X2 [Salmo salar] Length = 348 Score = 57.0 bits (136), Expect = 5e-06 Identities = 36/101 (35%), Positives = 55/101 (54%), Gaps = 9/101 (8%) Frame = -1 Query: 298 RGSLFMFPKFKPDVPALTQKMT------HLNMNAMAATRR--SSTSTAFVKD-TIANPNR 146 R S K + DVP L +K+ ++N + A RR SS ST F+ D T++ PN Sbjct: 64 RASTIFLSKSQTDVPVLNKKVREKRKSIYINHHHAAPVRRKYSSCSTIFLDDSTVSQPNL 123 Query: 145 SELLVCIAHALYYHMSTGMQTKVKIHEDIFSEKLHPMTREK 23 + C+A A+YYH+ + ++ DIF EKLHP+T+ + Sbjct: 124 KYTIKCVALAIYYHIKN-REIDGRMVLDIFDEKLHPLTKSE 163