BLASTX nr result
ID: Zanthoxylum22_contig00041963
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00041963 (328 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006483272.1| PREDICTED: pentatricopeptide repeat-containi... 162 9e-38 ref|XP_006438545.1| hypothetical protein CICLE_v10030848mg [Citr... 162 9e-38 gb|KDO82695.1| hypothetical protein CISIN_1g004470mg [Citrus sin... 159 8e-37 ref|XP_012091977.1| PREDICTED: pentatricopeptide repeat-containi... 140 4e-31 ref|XP_007044407.1| Pentatricopeptide repeat (PPR-like) superfam... 136 5e-30 ref|XP_010096308.1| hypothetical protein L484_021054 [Morus nota... 135 9e-30 ref|XP_012479485.1| PREDICTED: pentatricopeptide repeat-containi... 134 3e-29 ref|XP_007213619.1| hypothetical protein PRUPE_ppa002121mg [Prun... 132 8e-29 emb|CBI32045.3| unnamed protein product [Vitis vinifera] 131 2e-28 ref|XP_002268680.2| PREDICTED: pentatricopeptide repeat-containi... 131 2e-28 ref|XP_008228917.1| PREDICTED: pentatricopeptide repeat-containi... 130 4e-28 ref|XP_008389554.1| PREDICTED: pentatricopeptide repeat-containi... 127 2e-27 ref|XP_014510463.1| PREDICTED: pentatricopeptide repeat-containi... 124 4e-26 ref|XP_011009008.1| PREDICTED: pentatricopeptide repeat-containi... 124 4e-26 ref|XP_009360418.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 124 4e-26 ref|XP_007153868.1| hypothetical protein PHAVU_003G071600g [Phas... 122 8e-26 gb|KOM28209.1| hypothetical protein LR48_Vigan511s003200 [Vigna ... 120 5e-25 gb|KOM28208.1| hypothetical protein LR48_Vigan511s003100 [Vigna ... 120 5e-25 ref|XP_008339956.1| PREDICTED: pentatricopeptide repeat-containi... 120 5e-25 ref|XP_009770050.1| PREDICTED: pentatricopeptide repeat-containi... 119 7e-25 >ref|XP_006483272.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like isoform X1 [Citrus sinensis] gi|568859493|ref|XP_006483273.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like isoform X2 [Citrus sinensis] gi|568859495|ref|XP_006483274.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like isoform X3 [Citrus sinensis] Length = 751 Score = 162 bits (410), Expect = 9e-38 Identities = 80/109 (73%), Positives = 87/109 (79%), Gaps = 1/109 (0%) Frame = -3 Query: 326 RCAIFAFGPCFQLSSYHPKVGIAPSCLPFFF-RRCLSQRLSVLDSTNTRPFPDYSPKRPT 150 RC IF F C Q +++H VGI P CL FFF R LSQR L STNTRPFPDYSPKRPT Sbjct: 3 RCTIFTFYHCLQPNTHHSNVGIFPHCLRFFFFRGYLSQRSFALGSTNTRPFPDYSPKRPT 62 Query: 149 IRDSELVHQISTAIKLRRSEPLRRTLKPFESKFKPDHLIWAIMNIRGDY 3 IRDSE+VHQISTAIKLR SEPLR TLKPFESKF+PDHLIW +M+IR DY Sbjct: 63 IRDSEIVHQISTAIKLRCSEPLRHTLKPFESKFRPDHLIWVLMDIRSDY 111 >ref|XP_006438545.1| hypothetical protein CICLE_v10030848mg [Citrus clementina] gi|557540741|gb|ESR51785.1| hypothetical protein CICLE_v10030848mg [Citrus clementina] Length = 703 Score = 162 bits (410), Expect = 9e-38 Identities = 80/109 (73%), Positives = 87/109 (79%), Gaps = 1/109 (0%) Frame = -3 Query: 326 RCAIFAFGPCFQLSSYHPKVGIAPSCLPFFF-RRCLSQRLSVLDSTNTRPFPDYSPKRPT 150 RC IF F C Q +++H VGI P CL FFF R LSQR L STNTRPFPDYSPKRPT Sbjct: 3 RCTIFTFYHCLQPNTHHSNVGIFPHCLRFFFFRGYLSQRSFALGSTNTRPFPDYSPKRPT 62 Query: 149 IRDSELVHQISTAIKLRRSEPLRRTLKPFESKFKPDHLIWAIMNIRGDY 3 IRDSE+VHQISTAIKLR SEPLR TLKPFESKF+PDHLIW +M+IR DY Sbjct: 63 IRDSEIVHQISTAIKLRCSEPLRHTLKPFESKFRPDHLIWVLMDIRSDY 111 >gb|KDO82695.1| hypothetical protein CISIN_1g004470mg [Citrus sinensis] Length = 751 Score = 159 bits (402), Expect = 8e-37 Identities = 79/109 (72%), Positives = 86/109 (78%), Gaps = 1/109 (0%) Frame = -3 Query: 326 RCAIFAFGPCFQLSSYHPKVGIAPSCLPFFF-RRCLSQRLSVLDSTNTRPFPDYSPKRPT 150 RC IF F C Q +++H VGI P CL FFF R LSQR L STNTRPFPDYSPKRPT Sbjct: 3 RCTIFTFYHCLQPNTHHSNVGIFPHCLRFFFFRGYLSQRSFALGSTNTRPFPDYSPKRPT 62 Query: 149 IRDSELVHQISTAIKLRRSEPLRRTLKPFESKFKPDHLIWAIMNIRGDY 3 IRDSE+VHQISTAIKLR SEPLR TLKPFESKF+ DHLIW +M+IR DY Sbjct: 63 IRDSEIVHQISTAIKLRCSEPLRHTLKPFESKFRSDHLIWVLMDIRSDY 111 >ref|XP_012091977.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Jatropha curcas] gi|802787636|ref|XP_012091978.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Jatropha curcas] gi|802787640|ref|XP_012091979.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Jatropha curcas] gi|643704188|gb|KDP21252.1| hypothetical protein JCGZ_21723 [Jatropha curcas] Length = 750 Score = 140 bits (353), Expect = 4e-31 Identities = 69/108 (63%), Positives = 79/108 (73%) Frame = -3 Query: 326 RCAIFAFGPCFQLSSYHPKVGIAPSCLPFFFRRCLSQRLSVLDSTNTRPFPDYSPKRPTI 147 RC + +L S HP +GI P L F RR LSQ LS STNTRPFPDYSPK+PTI Sbjct: 3 RCVVLYSRLYLRLFSQHPFIGIPPHGLQLFVRRSLSQSLSSSRSTNTRPFPDYSPKKPTI 62 Query: 146 RDSELVHQISTAIKLRRSEPLRRTLKPFESKFKPDHLIWAIMNIRGDY 3 ++SELVHQIS IKLRRSEPL R LKP++SKF+ DHLIW +MNIR DY Sbjct: 63 KESELVHQISNTIKLRRSEPLGRILKPYKSKFRSDHLIWVLMNIRNDY 110 >ref|XP_007044407.1| Pentatricopeptide repeat (PPR-like) superfamily protein [Theobroma cacao] gi|508708342|gb|EOY00239.1| Pentatricopeptide repeat (PPR-like) superfamily protein [Theobroma cacao] Length = 750 Score = 136 bits (343), Expect = 5e-30 Identities = 66/108 (61%), Positives = 80/108 (74%) Frame = -3 Query: 326 RCAIFAFGPCFQLSSYHPKVGIAPSCLPFFFRRCLSQRLSVLDSTNTRPFPDYSPKRPTI 147 RCA+ + F L S+ + AP PFFF+R L Q L + DS TRPFP+Y PK+PTI Sbjct: 3 RCAVSSLSHYFHLFSHRYRRTFAPYSWPFFFKRYLGQILYLSDSGTTRPFPNYCPKKPTI 62 Query: 146 RDSELVHQISTAIKLRRSEPLRRTLKPFESKFKPDHLIWAIMNIRGDY 3 +DSELVHQISTAIKL RSEPL R L+P+ESKF+ DHLIW +MNI+GDY Sbjct: 63 KDSELVHQISTAIKLCRSEPLYRVLRPYESKFRSDHLIWVLMNIKGDY 110 >ref|XP_010096308.1| hypothetical protein L484_021054 [Morus notabilis] gi|587874648|gb|EXB63783.1| hypothetical protein L484_021054 [Morus notabilis] Length = 749 Score = 135 bits (341), Expect = 9e-30 Identities = 65/100 (65%), Positives = 78/100 (78%), Gaps = 1/100 (1%) Frame = -3 Query: 299 CFQLSSYHPKVGIAPSCLPFFFR-RCLSQRLSVLDSTNTRPFPDYSPKRPTIRDSELVHQ 123 C ++ S+HP + +C PFFF R LSQ LS STNTRPFPDYSPK+PTI+D+E VH Sbjct: 11 CLRIISHHPCLSFGSNCSPFFFLGRNLSQVLSA-SSTNTRPFPDYSPKKPTIKDAEFVHH 69 Query: 122 ISTAIKLRRSEPLRRTLKPFESKFKPDHLIWAIMNIRGDY 3 I+T IKLRRSEPLRR +KP+ESKF+ DHLIW +MNIR DY Sbjct: 70 ITTTIKLRRSEPLRRIMKPYESKFRSDHLIWTLMNIRNDY 109 >ref|XP_012479485.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial isoform X1 [Gossypium raimondii] gi|823159312|ref|XP_012479486.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial isoform X1 [Gossypium raimondii] gi|763764139|gb|KJB31393.1| hypothetical protein B456_005G189200 [Gossypium raimondii] gi|763764140|gb|KJB31394.1| hypothetical protein B456_005G189200 [Gossypium raimondii] Length = 750 Score = 134 bits (337), Expect = 3e-29 Identities = 64/106 (60%), Positives = 79/106 (74%) Frame = -3 Query: 320 AIFAFGPCFQLSSYHPKVGIAPSCLPFFFRRCLSQRLSVLDSTNTRPFPDYSPKRPTIRD 141 A+ + CFQL S+ AP P FF+R L L + DS NTRPFP+YSPK+PT++D Sbjct: 5 AVCSLSHCFQLLSHCYPQSFAPKSGPPFFKRYLGPILHLSDSANTRPFPNYSPKKPTVKD 64 Query: 140 SELVHQISTAIKLRRSEPLRRTLKPFESKFKPDHLIWAIMNIRGDY 3 SELVHQIS AIKLRRSEP+ R LKP+ESKF+ DHLIW +MNI+G+Y Sbjct: 65 SELVHQISNAIKLRRSEPVCRVLKPYESKFRSDHLIWVLMNIKGEY 110 >ref|XP_007213619.1| hypothetical protein PRUPE_ppa002121mg [Prunus persica] gi|462409484|gb|EMJ14818.1| hypothetical protein PRUPE_ppa002121mg [Prunus persica] Length = 713 Score = 132 bits (333), Expect = 8e-29 Identities = 69/108 (63%), Positives = 81/108 (75%) Frame = -3 Query: 326 RCAIFAFGPCFQLSSYHPKVGIAPSCLPFFFRRCLSQRLSVLDSTNTRPFPDYSPKRPTI 147 R IF+F FQ SS+ P + +A + FFFRRC+S LS STNTRPFPDYSPKRPTI Sbjct: 3 RLTIFSFYR-FQSSSHRPFLSLAVNSSLFFFRRCISHGLSS-GSTNTRPFPDYSPKRPTI 60 Query: 146 RDSELVHQISTAIKLRRSEPLRRTLKPFESKFKPDHLIWAIMNIRGDY 3 DSELV +IS IKLR SEPLRR LKP+ES+F+ DHLIW +MNI+ DY Sbjct: 61 NDSELVQRISNTIKLRCSEPLRRILKPYESQFRSDHLIWVLMNIKNDY 108 >emb|CBI32045.3| unnamed protein product [Vitis vinifera] Length = 648 Score = 131 bits (329), Expect = 2e-28 Identities = 66/99 (66%), Positives = 78/99 (78%) Frame = -3 Query: 299 CFQLSSYHPKVGIAPSCLPFFFRRCLSQRLSVLDSTNTRPFPDYSPKRPTIRDSELVHQI 120 CFQ+ SYH + A + L FF RRC S++LS DST TR FPDYSPK+P I+DSELVH+I Sbjct: 12 CFQVFSYHSHLDPALNRLSFF-RRCFSEKLSSFDST-TRNFPDYSPKKPIIQDSELVHRI 69 Query: 119 STAIKLRRSEPLRRTLKPFESKFKPDHLIWAIMNIRGDY 3 S AIK RRSEPLRR LKP+ESKF+ DHLIW +MNI+ DY Sbjct: 70 SIAIKQRRSEPLRRVLKPYESKFRADHLIWVLMNIKNDY 108 >ref|XP_002268680.2| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Vitis vinifera] gi|731374152|ref|XP_010652656.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Vitis vinifera] gi|731374156|ref|XP_010652663.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Vitis vinifera] gi|731374163|ref|XP_010652674.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Vitis vinifera] gi|731374167|ref|XP_010652679.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Vitis vinifera] gi|731374171|ref|XP_010652686.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Vitis vinifera] gi|731374175|ref|XP_010652689.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Vitis vinifera] gi|731374179|ref|XP_010652692.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Vitis vinifera] Length = 748 Score = 131 bits (329), Expect = 2e-28 Identities = 66/99 (66%), Positives = 78/99 (78%) Frame = -3 Query: 299 CFQLSSYHPKVGIAPSCLPFFFRRCLSQRLSVLDSTNTRPFPDYSPKRPTIRDSELVHQI 120 CFQ+ SYH + A + L FF RRC S++LS DST TR FPDYSPK+P I+DSELVH+I Sbjct: 12 CFQVFSYHSHLDPALNRLSFF-RRCFSEKLSSFDST-TRNFPDYSPKKPIIQDSELVHRI 69 Query: 119 STAIKLRRSEPLRRTLKPFESKFKPDHLIWAIMNIRGDY 3 S AIK RRSEPLRR LKP+ESKF+ DHLIW +MNI+ DY Sbjct: 70 SIAIKQRRSEPLRRVLKPYESKFRADHLIWVLMNIKNDY 108 >ref|XP_008228917.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Prunus mume] gi|645245521|ref|XP_008228918.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Prunus mume] gi|645245523|ref|XP_008228920.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Prunus mume] Length = 742 Score = 130 bits (327), Expect = 4e-28 Identities = 68/108 (62%), Positives = 81/108 (75%) Frame = -3 Query: 326 RCAIFAFGPCFQLSSYHPKVGIAPSCLPFFFRRCLSQRLSVLDSTNTRPFPDYSPKRPTI 147 R IF+F CFQ SS+ P + ++ + FFRRC+S LS STNTRPFPDYSPKRPTI Sbjct: 3 RSTIFSFY-CFQSSSHRPFLSLSVNS-SLFFRRCISHGLSS-GSTNTRPFPDYSPKRPTI 59 Query: 146 RDSELVHQISTAIKLRRSEPLRRTLKPFESKFKPDHLIWAIMNIRGDY 3 DSELV +IS IKLR SEPLRR LKP+ES+F+ DHLIW +MNI+ DY Sbjct: 60 NDSELVQRISNTIKLRCSEPLRRILKPYESQFRSDHLIWVLMNIKNDY 107 >ref|XP_008389554.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Malus domestica] gi|657994500|ref|XP_008389556.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Malus domestica] gi|658030953|ref|XP_008350930.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Malus domestica] gi|658030955|ref|XP_008350931.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Malus domestica] Length = 749 Score = 127 bits (320), Expect = 2e-27 Identities = 61/99 (61%), Positives = 75/99 (75%) Frame = -3 Query: 299 CFQLSSYHPKVGIAPSCLPFFFRRCLSQRLSVLDSTNTRPFPDYSPKRPTIRDSELVHQI 120 CFQ+S + P + + + F FRRCLS +S L ST+TRPFPDYSPK+PTI+D+ELVH I Sbjct: 11 CFQISYHRPCLNLGLNSSLFVFRRCLSHGIS-LGSTHTRPFPDYSPKKPTIKDAELVHLI 69 Query: 119 STAIKLRRSEPLRRTLKPFESKFKPDHLIWAIMNIRGDY 3 ST IKLR SEP R LKP+ES F+ DHLIW +MNI+ DY Sbjct: 70 STTIKLRCSEPFRSILKPYESNFRSDHLIWVLMNIKNDY 108 >ref|XP_014510463.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Vigna radiata var. radiata] Length = 738 Score = 124 bits (310), Expect = 4e-26 Identities = 58/108 (53%), Positives = 74/108 (68%) Frame = -3 Query: 326 RCAIFAFGPCFQLSSYHPKVGIAPSCLPFFFRRCLSQRLSVLDSTNTRPFPDYSPKRPTI 147 R I ++ CF+ +P +G P CL F S L S+N RPFPDYSP++P++ Sbjct: 3 RAVISSYFNCFRYYDRNPFMGFCPKCLSVKF-------CSSLGSSNARPFPDYSPRKPSV 55 Query: 146 RDSELVHQISTAIKLRRSEPLRRTLKPFESKFKPDHLIWAIMNIRGDY 3 +DS+ VH IST +K RRSEPLRR LKPFE+KFKPDHLIW +MNI+ DY Sbjct: 56 KDSDFVHHISTTVKQRRSEPLRRILKPFEAKFKPDHLIWVLMNIKDDY 103 >ref|XP_011009008.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Populus euphratica] gi|743929551|ref|XP_011009010.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Populus euphratica] Length = 748 Score = 124 bits (310), Expect = 4e-26 Identities = 64/108 (59%), Positives = 74/108 (68%) Frame = -3 Query: 326 RCAIFAFGPCFQLSSYHPKVGIAPSCLPFFFRRCLSQRLSVLDSTNTRPFPDYSPKRPTI 147 RCAI G F S H +G +P LPF R LSQ L S+NTRPFP+YSPK+P I Sbjct: 3 RCAIIFLGYSFPHFSCHVCLGFSPIRLPFLVGRYLSQSLH--SSSNTRPFPNYSPKKPAI 60 Query: 146 RDSELVHQISTAIKLRRSEPLRRTLKPFESKFKPDHLIWAIMNIRGDY 3 D++LVHQIS IKLR SEPL LKP+ESKF+ DHLIW +MNIR DY Sbjct: 61 LDAQLVHQISNTIKLRHSEPLWHILKPYESKFRSDHLIWVLMNIRHDY 108 >ref|XP_009360418.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Pyrus x bretschneideri] Length = 728 Score = 124 bits (310), Expect = 4e-26 Identities = 60/99 (60%), Positives = 74/99 (74%) Frame = -3 Query: 299 CFQLSSYHPKVGIAPSCLPFFFRRCLSQRLSVLDSTNTRPFPDYSPKRPTIRDSELVHQI 120 CFQ+S + P + IA + F FRR LS +S L T+TRPFPDYSPK+P I+D+ELVH+I Sbjct: 11 CFQISCHRPHLNIAVNSSLFVFRRFLSHGIS-LGLTDTRPFPDYSPKKPPIKDAELVHRI 69 Query: 119 STAIKLRRSEPLRRTLKPFESKFKPDHLIWAIMNIRGDY 3 ST IKLR SEP R LKP+ES F+ DHLIW +MNI+ DY Sbjct: 70 STTIKLRCSEPFRSILKPYESNFRSDHLIWVLMNIKNDY 108 >ref|XP_007153868.1| hypothetical protein PHAVU_003G071600g [Phaseolus vulgaris] gi|561027222|gb|ESW25862.1| hypothetical protein PHAVU_003G071600g [Phaseolus vulgaris] Length = 697 Score = 122 bits (307), Expect = 8e-26 Identities = 57/108 (52%), Positives = 75/108 (69%) Frame = -3 Query: 326 RCAIFAFGPCFQLSSYHPKVGIAPSCLPFFFRRCLSQRLSVLDSTNTRPFPDYSPKRPTI 147 R A ++ C + S ++P +G P CL F S LDS+N RPFPDYSPK+P++ Sbjct: 3 RAAFSSYFHCLRYSYHNPFMGFGPKCLNVKFS-------SSLDSSNARPFPDYSPKKPSV 55 Query: 146 RDSELVHQISTAIKLRRSEPLRRTLKPFESKFKPDHLIWAIMNIRGDY 3 +D++ VH +ST IK RRSEPLRR LKPFE+KFKPD+ IW +MNI+ DY Sbjct: 56 KDTDFVHHLSTTIKQRRSEPLRRILKPFEAKFKPDYFIWVLMNIKDDY 103 >gb|KOM28209.1| hypothetical protein LR48_Vigan511s003200 [Vigna angularis] Length = 245 Score = 120 bits (300), Expect = 5e-25 Identities = 55/108 (50%), Positives = 73/108 (67%) Frame = -3 Query: 326 RCAIFAFGPCFQLSSYHPKVGIAPSCLPFFFRRCLSQRLSVLDSTNTRPFPDYSPKRPTI 147 R I ++ CF+ + +P +G P CL F S L +N RPFPDYSP++P++ Sbjct: 3 RAVISSYFNCFRYNDRNPFMGFGPKCLSVKFS-------SSLGLSNARPFPDYSPRKPSV 55 Query: 146 RDSELVHQISTAIKLRRSEPLRRTLKPFESKFKPDHLIWAIMNIRGDY 3 +D++ VH IST +K RRSEPLRR LKPFE+KFKPDH IW +MNI+ DY Sbjct: 56 KDTDFVHHISTTVKQRRSEPLRRILKPFEAKFKPDHFIWVLMNIKDDY 103 >gb|KOM28208.1| hypothetical protein LR48_Vigan511s003100 [Vigna angularis] Length = 738 Score = 120 bits (300), Expect = 5e-25 Identities = 55/108 (50%), Positives = 73/108 (67%) Frame = -3 Query: 326 RCAIFAFGPCFQLSSYHPKVGIAPSCLPFFFRRCLSQRLSVLDSTNTRPFPDYSPKRPTI 147 R I ++ CF+ + +P +G P CL F S L +N RPFPDYSP++P++ Sbjct: 3 RAVISSYFNCFRYNDRNPFMGFGPKCLSVKFS-------SSLGLSNARPFPDYSPRKPSV 55 Query: 146 RDSELVHQISTAIKLRRSEPLRRTLKPFESKFKPDHLIWAIMNIRGDY 3 +D++ VH IST +K RRSEPLRR LKPFE+KFKPDH IW +MNI+ DY Sbjct: 56 KDTDFVHHISTTVKQRRSEPLRRILKPFEAKFKPDHFIWVLMNIKDDY 103 >ref|XP_008339956.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Malus domestica] gi|658009489|ref|XP_008339957.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Malus domestica] gi|658009491|ref|XP_008339958.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Malus domestica] Length = 748 Score = 120 bits (300), Expect = 5e-25 Identities = 58/98 (59%), Positives = 74/98 (75%) Frame = -3 Query: 296 FQLSSYHPKVGIAPSCLPFFFRRCLSQRLSVLDSTNTRPFPDYSPKRPTIRDSELVHQIS 117 FQ+S +H + +A + F FRRCLS +S L +T+TRPFPDYSPK+P+I+D+ELVH+IS Sbjct: 12 FQISHHHLCLNLAVNSSLFIFRRCLSHGIS-LGATHTRPFPDYSPKKPSIKDAELVHRIS 70 Query: 116 TAIKLRRSEPLRRTLKPFESKFKPDHLIWAIMNIRGDY 3 T IKLR SEP LKP+ES F DHLIW +MNI+ DY Sbjct: 71 TTIKLRCSEPFCSILKPYESHFXSDHLIWVLMNIKNDY 108 >ref|XP_009770050.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Nicotiana sylvestris] gi|698553855|ref|XP_009770051.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Nicotiana sylvestris] gi|698553859|ref|XP_009770052.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Nicotiana sylvestris] gi|698553862|ref|XP_009770053.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Nicotiana sylvestris] gi|698553866|ref|XP_009770054.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Nicotiana sylvestris] gi|698553870|ref|XP_009770055.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Nicotiana sylvestris] gi|698553873|ref|XP_009770056.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Nicotiana sylvestris] gi|698553876|ref|XP_009770057.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Nicotiana sylvestris] gi|698553879|ref|XP_009770058.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Nicotiana sylvestris] gi|698553883|ref|XP_009770059.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Nicotiana sylvestris] gi|698553887|ref|XP_009770060.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Nicotiana sylvestris] gi|698553890|ref|XP_009770061.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Nicotiana sylvestris] gi|698553894|ref|XP_009770062.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Nicotiana sylvestris] Length = 752 Score = 119 bits (299), Expect = 7e-25 Identities = 58/110 (52%), Positives = 74/110 (67%), Gaps = 2/110 (1%) Frame = -3 Query: 326 RCAIFAFGPCFQLSSYHPKVG--IAPSCLPFFFRRCLSQRLSVLDSTNTRPFPDYSPKRP 153 RC+IF F QL SYH +G I + F C ++LS L T RPFPDYSPK+ Sbjct: 3 RCSIFVFSYHCQLLSYHQYLGSVIKHTSFSCFSTNCAVEKLSFLPLTAARPFPDYSPKKA 62 Query: 152 TIRDSELVHQISTAIKLRRSEPLRRTLKPFESKFKPDHLIWAIMNIRGDY 3 +IRDSELVH ++T+IK R SE + R LKPFESK +PDH+IW +MN++ DY Sbjct: 63 SIRDSELVHHVATSIKQRYSEHIHRVLKPFESKIRPDHIIWVLMNVKNDY 112