BLASTX nr result
ID: Zanthoxylum22_contig00041682
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00041682 (338 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN61218.1| hypothetical protein VITISV_021295 [Vitis vinifera] 45 1e-07 emb|CAN77834.1| hypothetical protein VITISV_024733 [Vitis vinifera] 40 6e-07 emb|CAN65817.1| hypothetical protein VITISV_000093 [Vitis vinifera] 40 6e-07 emb|CAN65230.1| hypothetical protein VITISV_034221 [Vitis vinifera] 41 1e-06 emb|CAN63128.1| hypothetical protein VITISV_042536 [Vitis vinifera] 41 1e-06 emb|CAN76386.1| hypothetical protein VITISV_014735 [Vitis vinifera] 40 1e-06 emb|CAN70808.1| hypothetical protein VITISV_037883 [Vitis vinifera] 41 1e-06 emb|CAN73587.1| hypothetical protein VITISV_033962 [Vitis vinifera] 43 1e-06 emb|CAN78142.1| hypothetical protein VITISV_015958 [Vitis vinifera] 40 2e-06 emb|CAN82358.1| hypothetical protein VITISV_027366 [Vitis vinifera] 40 2e-06 emb|CAN73326.1| hypothetical protein VITISV_036505 [Vitis vinifera] 40 2e-06 emb|CAN63606.1| hypothetical protein VITISV_019130 [Vitis vinifera] 40 2e-06 emb|CAN74337.1| hypothetical protein VITISV_039506 [Vitis vinifera] 40 2e-06 emb|CAN81916.1| hypothetical protein VITISV_038548 [Vitis vinifera] 40 2e-06 emb|CAN81940.1| hypothetical protein VITISV_007358 [Vitis vinifera] 40 2e-06 emb|CAN83335.1| hypothetical protein VITISV_043861 [Vitis vinifera] 40 2e-06 emb|CAN62329.1| hypothetical protein VITISV_029808 [Vitis vinifera] 40 2e-06 emb|CAN73450.1| hypothetical protein VITISV_028990 [Vitis vinifera] 40 2e-06 emb|CAN69964.1| hypothetical protein VITISV_000497 [Vitis vinifera] 40 2e-06 emb|CAN74104.1| hypothetical protein VITISV_008952 [Vitis vinifera] 40 3e-06 >emb|CAN61218.1| hypothetical protein VITISV_021295 [Vitis vinifera] Length = 107 Score = 45.4 bits (106), Expect(2) = 1e-07 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = -3 Query: 246 FTKSLRGLCIDFICNKLSAYNIYVLA 169 FTKSLRGL I +ICNKL AYNIY LA Sbjct: 82 FTKSLRGLRIKYICNKLGAYNIYALA 107 Score = 37.4 bits (85), Expect(2) = 1e-07 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 1/32 (3%) Frame = -2 Query: 337 IDVECHFIK-RILS*CITLSFINSES*LADVF 245 I+V+CHFI+ +I S C+ SF+NS LAD+F Sbjct: 51 IEVDCHFIREKIASGCMATSFVNSNDQLADIF 82 >emb|CAN77834.1| hypothetical protein VITISV_024733 [Vitis vinifera] Length = 1300 Score = 40.0 bits (92), Expect(2) = 6e-07 Identities = 18/32 (56%), Positives = 25/32 (78%), Gaps = 1/32 (3%) Frame = -2 Query: 337 IDVECHFIK-RILS*CITLSFINSES*LADVF 245 I+V+CHFI+ +I S C+T SF+NS LAD+F Sbjct: 1244 IEVDCHFIREKIASGCVTTSFVNSNDQLADIF 1275 Score = 40.0 bits (92), Expect(2) = 6e-07 Identities = 19/26 (73%), Positives = 20/26 (76%) Frame = -3 Query: 246 FTKSLRGLCIDFICNKLSAYNIYVLA 169 FTKSLRG I +ICNKL AYNIY A Sbjct: 1275 FTKSLRGPRIKYICNKLGAYNIYAPA 1300 >emb|CAN65817.1| hypothetical protein VITISV_000093 [Vitis vinifera] Length = 101 Score = 40.0 bits (92), Expect(2) = 6e-07 Identities = 18/32 (56%), Positives = 25/32 (78%), Gaps = 1/32 (3%) Frame = -2 Query: 337 IDVECHFIK-RILS*CITLSFINSES*LADVF 245 I+V+CHFI+ +I S C+T SF+NS LAD+F Sbjct: 45 IEVDCHFIREKIASGCVTTSFVNSNDQLADIF 76 Score = 40.0 bits (92), Expect(2) = 6e-07 Identities = 19/26 (73%), Positives = 20/26 (76%) Frame = -3 Query: 246 FTKSLRGLCIDFICNKLSAYNIYVLA 169 FTKSLRG I +ICNKL AYNIY A Sbjct: 76 FTKSLRGPRIKYICNKLGAYNIYAPA 101 >emb|CAN65230.1| hypothetical protein VITISV_034221 [Vitis vinifera] Length = 482 Score = 41.2 bits (95), Expect(2) = 1e-06 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -3 Query: 246 FTKSLRGLCIDFICNKLSAYNIYVLA 169 FTKSLRGL I +ICNKL AY++Y A Sbjct: 457 FTKSLRGLMIKYICNKLGAYDVYAPA 482 Score = 38.1 bits (87), Expect(2) = 1e-06 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 1/32 (3%) Frame = -2 Query: 337 IDVECHFIK-RILS*CITLSFINSES*LADVF 245 I+V+CHFI+ +I S C+ SF+NS LAD+F Sbjct: 426 IEVDCHFIREKIASGCVATSFVNSNDQLADIF 457 >emb|CAN63128.1| hypothetical protein VITISV_042536 [Vitis vinifera] Length = 107 Score = 40.8 bits (94), Expect(2) = 1e-06 Identities = 19/26 (73%), Positives = 21/26 (80%) Frame = -3 Query: 246 FTKSLRGLCIDFICNKLSAYNIYVLA 169 FTKSLRG I +ICNKL AY+IY LA Sbjct: 82 FTKSLRGPRIKYICNKLGAYDIYALA 107 Score = 38.1 bits (87), Expect(2) = 1e-06 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 1/32 (3%) Frame = -2 Query: 337 IDVECHFIK-RILS*CITLSFINSES*LADVF 245 I+V+CHFI+ +I S C+ SF+NS LAD+F Sbjct: 51 IEVDCHFIREKIASGCVATSFVNSNDQLADIF 82 >emb|CAN76386.1| hypothetical protein VITISV_014735 [Vitis vinifera] Length = 107 Score = 40.0 bits (92), Expect(2) = 1e-06 Identities = 19/26 (73%), Positives = 20/26 (76%) Frame = -3 Query: 246 FTKSLRGLCIDFICNKLSAYNIYVLA 169 FTKSLRG I +ICNKL AYNIY A Sbjct: 82 FTKSLRGPRIKYICNKLDAYNIYAPA 107 Score = 38.9 bits (89), Expect(2) = 1e-06 Identities = 18/32 (56%), Positives = 24/32 (75%), Gaps = 1/32 (3%) Frame = -2 Query: 337 IDVECHFIK-RILS*CITLSFINSES*LADVF 245 I V+CHFI+ +I S C+T SF+NS LAD+F Sbjct: 51 IKVDCHFIREKIASGCVTTSFVNSNDQLADIF 82 >emb|CAN70808.1| hypothetical protein VITISV_037883 [Vitis vinifera] Length = 94 Score = 40.8 bits (94), Expect(2) = 1e-06 Identities = 19/26 (73%), Positives = 20/26 (76%) Frame = -3 Query: 246 FTKSLRGLCIDFICNKLSAYNIYVLA 169 FTKSLRG I +ICNKL AYNIY A Sbjct: 69 FTKSLRGPRIKYICNKLGAYNIYAXA 94 Score = 38.1 bits (87), Expect(2) = 1e-06 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 1/32 (3%) Frame = -2 Query: 337 IDVECHFIK-RILS*CITLSFINSES*LADVF 245 I+V+CHFI+ +I S C+ SF+NS LAD+F Sbjct: 38 IEVDCHFIREKIASGCVATSFVNSNDQLADIF 69 >emb|CAN73587.1| hypothetical protein VITISV_033962 [Vitis vinifera] Length = 92 Score = 42.7 bits (99), Expect(2) = 1e-06 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -3 Query: 246 FTKSLRGLCIDFICNKLSAYNIYVLA 169 FTKSLRGL I +ICNKL AYNIY A Sbjct: 67 FTKSLRGLRIKYICNKLGAYNIYAPA 92 Score = 36.2 bits (82), Expect(2) = 1e-06 Identities = 16/32 (50%), Positives = 23/32 (71%), Gaps = 1/32 (3%) Frame = -2 Query: 337 IDVECHFIK-RILS*CITLSFINSES*LADVF 245 I+V+CHFI+ +I S C+ SF+NS L D+F Sbjct: 36 IEVDCHFIREKIASGCVATSFVNSNDQLXDIF 67 >emb|CAN78142.1| hypothetical protein VITISV_015958 [Vitis vinifera] Length = 466 Score = 40.4 bits (93), Expect(2) = 2e-06 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -3 Query: 246 FTKSLRGLCIDFICNKLSAYNIYVLA 169 FTKSLRGL I +ICNKL AY++Y A Sbjct: 441 FTKSLRGLRIKYICNKLGAYDVYAPA 466 Score = 38.1 bits (87), Expect(2) = 2e-06 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 1/32 (3%) Frame = -2 Query: 337 IDVECHFIK-RILS*CITLSFINSES*LADVF 245 I+V+CHFI+ +I S C+ SF+NS LAD+F Sbjct: 410 IEVDCHFIREKIASGCVATSFVNSNDQLADIF 441 >emb|CAN82358.1| hypothetical protein VITISV_027366 [Vitis vinifera] Length = 107 Score = 40.4 bits (93), Expect(2) = 2e-06 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -3 Query: 246 FTKSLRGLCIDFICNKLSAYNIYVLA 169 FTKSLRGL I +ICNKL AY++Y A Sbjct: 82 FTKSLRGLRIKYICNKLGAYDVYAPA 107 Score = 38.1 bits (87), Expect(2) = 2e-06 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 1/32 (3%) Frame = -2 Query: 337 IDVECHFIK-RILS*CITLSFINSES*LADVF 245 I+V+CHFI+ +I S C+ SF+NS LAD+F Sbjct: 51 IEVDCHFIREKIASGCVATSFVNSNDQLADIF 82 >emb|CAN73326.1| hypothetical protein VITISV_036505 [Vitis vinifera] Length = 107 Score = 40.4 bits (93), Expect(2) = 2e-06 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -3 Query: 246 FTKSLRGLCIDFICNKLSAYNIYVLA 169 FTKSLRGL I +ICNKL AY++Y A Sbjct: 82 FTKSLRGLRIKYICNKLGAYDVYAPA 107 Score = 38.1 bits (87), Expect(2) = 2e-06 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 1/32 (3%) Frame = -2 Query: 337 IDVECHFIK-RILS*CITLSFINSES*LADVF 245 I+V+CHFI+ +I S C+ SF+NS LAD+F Sbjct: 51 IEVDCHFIREKIASGCVATSFVNSNDQLADIF 82 >emb|CAN63606.1| hypothetical protein VITISV_019130 [Vitis vinifera] Length = 107 Score = 40.4 bits (93), Expect(2) = 2e-06 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -3 Query: 246 FTKSLRGLCIDFICNKLSAYNIY 178 FTKSLRGL I +ICNKL AY+IY Sbjct: 82 FTKSLRGLRIKYICNKLGAYDIY 104 Score = 38.1 bits (87), Expect(2) = 2e-06 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 1/32 (3%) Frame = -2 Query: 337 IDVECHFIK-RILS*CITLSFINSES*LADVF 245 I+V+CHFI+ +I S C+ SF+NS LAD+F Sbjct: 51 IEVDCHFIREKIASGCVVTSFVNSNDQLADIF 82 >emb|CAN74337.1| hypothetical protein VITISV_039506 [Vitis vinifera] Length = 107 Score = 40.4 bits (93), Expect(2) = 2e-06 Identities = 19/26 (73%), Positives = 21/26 (80%) Frame = -3 Query: 246 FTKSLRGLCIDFICNKLSAYNIYVLA 169 FTKSL+G I +ICNKL AYNIYV A Sbjct: 82 FTKSLKGPRIKYICNKLGAYNIYVPA 107 Score = 38.1 bits (87), Expect(2) = 2e-06 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 1/32 (3%) Frame = -2 Query: 337 IDVECHFIK-RILS*CITLSFINSES*LADVF 245 I+V+CHFI+ +I S C+ SF+NS LAD+F Sbjct: 51 IEVDCHFIREKIASGCVATSFVNSNDQLADIF 82 >emb|CAN81916.1| hypothetical protein VITISV_038548 [Vitis vinifera] Length = 1202 Score = 40.0 bits (92), Expect(2) = 2e-06 Identities = 19/26 (73%), Positives = 20/26 (76%) Frame = -3 Query: 246 FTKSLRGLCIDFICNKLSAYNIYVLA 169 FTKSLRG I +ICNKL AYNIY A Sbjct: 1177 FTKSLRGPRIKYICNKLGAYNIYAPA 1202 Score = 38.1 bits (87), Expect(2) = 2e-06 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 1/32 (3%) Frame = -2 Query: 337 IDVECHFIK-RILS*CITLSFINSES*LADVF 245 I+V+CHFI+ +I S C+ SF+NS LAD+F Sbjct: 1146 IEVDCHFIREKIASGCVATSFVNSNDQLADIF 1177 >emb|CAN81940.1| hypothetical protein VITISV_007358 [Vitis vinifera] Length = 772 Score = 40.0 bits (92), Expect(2) = 2e-06 Identities = 19/26 (73%), Positives = 20/26 (76%) Frame = -3 Query: 246 FTKSLRGLCIDFICNKLSAYNIYVLA 169 FTKSLRG I +ICNKL AYNIY A Sbjct: 747 FTKSLRGPRIKYICNKLGAYNIYAPA 772 Score = 38.1 bits (87), Expect(2) = 2e-06 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 1/32 (3%) Frame = -2 Query: 337 IDVECHFIK-RILS*CITLSFINSES*LADVF 245 I+V+CHFI+ +I S C+ SF+NS LAD+F Sbjct: 716 IEVDCHFIREKIASRCVATSFVNSNDQLADIF 747 >emb|CAN83335.1| hypothetical protein VITISV_043861 [Vitis vinifera] Length = 603 Score = 40.4 bits (93), Expect(2) = 2e-06 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -3 Query: 246 FTKSLRGLCIDFICNKLSAYNIY 178 FTKSLRG I +ICNKL AYNIY Sbjct: 578 FTKSLRGPXIKYICNKLGAYNIY 600 Score = 37.7 bits (86), Expect(2) = 2e-06 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 1/32 (3%) Frame = -2 Query: 337 IDVECHFIK-RILS*CITLSFINSES*LADVF 245 I+V+CHFI+ +I C+T SF+NS LAD+F Sbjct: 547 IEVDCHFIREKIALGCVTTSFVNSNDQLADIF 578 >emb|CAN62329.1| hypothetical protein VITISV_029808 [Vitis vinifera] Length = 374 Score = 40.0 bits (92), Expect(2) = 2e-06 Identities = 19/26 (73%), Positives = 20/26 (76%) Frame = -3 Query: 246 FTKSLRGLCIDFICNKLSAYNIYVLA 169 FTKSLRG I +ICNKL AYNIY A Sbjct: 349 FTKSLRGPRIKYICNKLGAYNIYAPA 374 Score = 38.1 bits (87), Expect(2) = 2e-06 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 1/32 (3%) Frame = -2 Query: 337 IDVECHFIK-RILS*CITLSFINSES*LADVF 245 I+V+CHFI+ +I S C+ SF+NS LAD+F Sbjct: 318 IEVDCHFIREKIASGCVATSFVNSNBQLADIF 349 >emb|CAN73450.1| hypothetical protein VITISV_028990 [Vitis vinifera] Length = 107 Score = 40.0 bits (92), Expect(2) = 2e-06 Identities = 19/26 (73%), Positives = 20/26 (76%) Frame = -3 Query: 246 FTKSLRGLCIDFICNKLSAYNIYVLA 169 FTKSLRG I +ICNKL AYNIY A Sbjct: 82 FTKSLRGPRIKYICNKLGAYNIYAPA 107 Score = 38.1 bits (87), Expect(2) = 2e-06 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 1/32 (3%) Frame = -2 Query: 337 IDVECHFIK-RILS*CITLSFINSES*LADVF 245 I+V+CHFI+ +I S C+ SF+NS LAD+F Sbjct: 51 IEVDCHFIREKIASGCVATSFVNSNBQLADIF 82 >emb|CAN69964.1| hypothetical protein VITISV_000497 [Vitis vinifera] Length = 82 Score = 40.0 bits (92), Expect(2) = 2e-06 Identities = 19/26 (73%), Positives = 20/26 (76%) Frame = -3 Query: 246 FTKSLRGLCIDFICNKLSAYNIYVLA 169 FTKSLRG I +ICNKL AYNIY A Sbjct: 57 FTKSLRGPKIKYICNKLGAYNIYAPA 82 Score = 38.1 bits (87), Expect(2) = 2e-06 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 1/32 (3%) Frame = -2 Query: 337 IDVECHFIK-RILS*CITLSFINSES*LADVF 245 I+V+CHFI+ +I S C+ SF+NS LAD+F Sbjct: 26 IEVDCHFIREKIASGCVATSFVNSNDQLADIF 57 >emb|CAN74104.1| hypothetical protein VITISV_008952 [Vitis vinifera] Length = 1211 Score = 40.0 bits (92), Expect(2) = 3e-06 Identities = 19/26 (73%), Positives = 20/26 (76%) Frame = -3 Query: 246 FTKSLRGLCIDFICNKLSAYNIYVLA 169 FTKSLRG I +ICNKL AYNIY A Sbjct: 1186 FTKSLRGPRIKYICNKLGAYNIYAPA 1211 Score = 37.7 bits (86), Expect(2) = 3e-06 Identities = 16/32 (50%), Positives = 24/32 (75%), Gaps = 1/32 (3%) Frame = -2 Query: 337 IDVECHFIK-RILS*CITLSFINSES*LADVF 245 I+++CHFI+ +I S C+ SF+NS LAD+F Sbjct: 1155 IEIDCHFIREKIASGCVATSFVNSNDQLADIF 1186