BLASTX nr result
ID: Zanthoxylum22_contig00041639
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00041639 (481 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO81209.1| hypothetical protein CISIN_1g0053811mg, partial [... 61 3e-07 >gb|KDO81209.1| hypothetical protein CISIN_1g0053811mg, partial [Citrus sinensis] gi|641862523|gb|KDO81210.1| hypothetical protein CISIN_1g0053811mg, partial [Citrus sinensis] Length = 344 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 478 THVRYYKDQHSLILLQQVLFVSGILFPEKGSP 383 THV+YYKDQHSL+LLQQV F+SGI FPEKGSP Sbjct: 312 THVQYYKDQHSLVLLQQVFFLSGIPFPEKGSP 343