BLASTX nr result
ID: Zanthoxylum22_contig00041626
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00041626 (505 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO72786.1| hypothetical protein CISIN_1g042807mg, partial [C... 89 1e-15 ref|XP_006431313.1| hypothetical protein CICLE_v10013325mg, part... 77 6e-12 >gb|KDO72786.1| hypothetical protein CISIN_1g042807mg, partial [Citrus sinensis] Length = 343 Score = 89.0 bits (219), Expect = 1e-15 Identities = 53/75 (70%), Positives = 55/75 (73%), Gaps = 3/75 (4%) Frame = -3 Query: 218 TPFGIDSTLQPPFVKII--KAGTEIAAGSVLGVENKNRMVKLNQLKRIPAIELREDVRLT 45 T FGI+S LQPPFV I K GTEIA S GVE KNRM KLNQLK IPA EL EDVRL Sbjct: 2 TLFGIESILQPPFVNITRTKTGTEIATRSDFGVEIKNRMEKLNQLKTIPANELHEDVRLP 61 Query: 44 NMVQM-NNVSTLSLP 3 MVQ NN+STLSLP Sbjct: 62 KMVQKNNNMSTLSLP 76 >ref|XP_006431313.1| hypothetical protein CICLE_v10013325mg, partial [Citrus clementina] gi|557533370|gb|ESR44553.1| hypothetical protein CICLE_v10013325mg, partial [Citrus clementina] Length = 332 Score = 76.6 bits (187), Expect = 6e-12 Identities = 46/65 (70%), Positives = 47/65 (72%), Gaps = 3/65 (4%) Frame = -3 Query: 188 PPFVKIIKA--GTEIAAGSVLGVENKNRMVKLNQLKRIPAIELREDVRLTNMVQM-NNVS 18 PPFV I K GTEIA S GVE KNRM KLNQLK IPA EL EDVRL MVQ NN+S Sbjct: 1 PPFVNITKTKTGTEIATRSDFGVEIKNRMEKLNQLKTIPANELHEDVRLPKMVQKNNNMS 60 Query: 17 TLSLP 3 TLSLP Sbjct: 61 TLSLP 65