BLASTX nr result
ID: Zanthoxylum22_contig00041335
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00041335 (349 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006482464.1| PREDICTED: pentatricopeptide repeat-containi... 82 1e-13 gb|KDO72337.1| hypothetical protein CISIN_1g002718mg [Citrus sin... 82 2e-13 ref|XP_006430993.1| hypothetical protein CICLE_v10011041mg [Citr... 82 2e-13 ref|XP_012088086.1| PREDICTED: pentatricopeptide repeat-containi... 75 2e-11 gb|KDP24314.1| hypothetical protein JCGZ_25610 [Jatropha curcas] 75 2e-11 ref|XP_010100885.1| hypothetical protein L484_009655 [Morus nota... 73 7e-11 ref|XP_006384245.1| hypothetical protein POPTR_0004s11010g [Popu... 69 1e-09 ref|XP_007217021.1| hypothetical protein PRUPE_ppa001933mg [Prun... 69 1e-09 ref|XP_007032935.1| Pentatricopeptide repeat (PPR) superfamily p... 69 1e-09 ref|XP_008244547.1| PREDICTED: pentatricopeptide repeat-containi... 69 2e-09 ref|XP_011009905.1| PREDICTED: pentatricopeptide repeat-containi... 68 2e-09 ref|XP_004491978.1| PREDICTED: pentatricopeptide repeat-containi... 68 3e-09 ref|XP_014496896.1| PREDICTED: pentatricopeptide repeat-containi... 67 4e-09 ref|XP_003551787.1| PREDICTED: pentatricopeptide repeat-containi... 67 4e-09 gb|KHN13782.1| Pentatricopeptide repeat-containing protein [Glyc... 67 7e-09 ref|XP_009373813.1| PREDICTED: pentatricopeptide repeat-containi... 66 1e-08 gb|KHN14453.1| Pentatricopeptide repeat-containing protein [Glyc... 65 2e-08 ref|XP_003530462.1| PREDICTED: pentatricopeptide repeat-containi... 65 2e-08 gb|KOM27023.1| hypothetical protein LR48_Vigan358s000100 [Vigna ... 65 3e-08 ref|XP_011658918.1| PREDICTED: pentatricopeptide repeat-containi... 65 3e-08 >ref|XP_006482464.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330-like [Citrus sinensis] Length = 892 Score = 82.4 bits (202), Expect = 1e-13 Identities = 39/51 (76%), Positives = 42/51 (82%) Frame = -3 Query: 347 WIEVEDKVHAFLVWDKAHPKCEEMYEKLGLLIGEMKPDGYAMDVDYEEAEE 195 WIEV DKVH FLV DK HPKCEE+YEKLGLLIGEMK G A DV+YE+ EE Sbjct: 824 WIEVNDKVHTFLVRDKDHPKCEEIYEKLGLLIGEMKWRGCASDVNYEKVEE 874 >gb|KDO72337.1| hypothetical protein CISIN_1g002718mg [Citrus sinensis] Length = 888 Score = 81.6 bits (200), Expect = 2e-13 Identities = 40/55 (72%), Positives = 43/55 (78%) Frame = -3 Query: 347 WIEVEDKVHAFLVWDKAHPKCEEMYEKLGLLIGEMKPDGYAMDVDYEEAEESE*Q 183 WI V DKVH FLV DK HPKCEE+YEKLGLLIGEMK G A DV+YE+ EE E Q Sbjct: 824 WIGVNDKVHTFLVRDKDHPKCEEIYEKLGLLIGEMKWRGCASDVNYEKVEEHESQ 878 >ref|XP_006430993.1| hypothetical protein CICLE_v10011041mg [Citrus clementina] gi|557533050|gb|ESR44233.1| hypothetical protein CICLE_v10011041mg [Citrus clementina] Length = 888 Score = 81.6 bits (200), Expect = 2e-13 Identities = 40/55 (72%), Positives = 43/55 (78%) Frame = -3 Query: 347 WIEVEDKVHAFLVWDKAHPKCEEMYEKLGLLIGEMKPDGYAMDVDYEEAEESE*Q 183 WI V DKVH FLV DK HPKCEE+YEKLGLLIGEMK G A DV+YE+ EE E Q Sbjct: 824 WIGVNDKVHTFLVRDKDHPKCEEIYEKLGLLIGEMKWRGCASDVNYEKVEEHESQ 878 >ref|XP_012088086.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 [Jatropha curcas] Length = 889 Score = 75.1 bits (183), Expect = 2e-11 Identities = 32/53 (60%), Positives = 42/53 (79%) Frame = -3 Query: 347 WIEVEDKVHAFLVWDKAHPKCEEMYEKLGLLIGEMKPDGYAMDVDYEEAEESE 189 WIE++D++HAFLV D+AHP+CEE+YE L +LI EMK DGY D D+ EE+E Sbjct: 825 WIELKDELHAFLVGDEAHPRCEELYEILDVLINEMKRDGYLPDADFSPGEEAE 877 >gb|KDP24314.1| hypothetical protein JCGZ_25610 [Jatropha curcas] Length = 772 Score = 75.1 bits (183), Expect = 2e-11 Identities = 32/53 (60%), Positives = 42/53 (79%) Frame = -3 Query: 347 WIEVEDKVHAFLVWDKAHPKCEEMYEKLGLLIGEMKPDGYAMDVDYEEAEESE 189 WIE++D++HAFLV D+AHP+CEE+YE L +LI EMK DGY D D+ EE+E Sbjct: 708 WIELKDELHAFLVGDEAHPRCEELYEILDVLINEMKRDGYLPDADFSPGEEAE 760 >ref|XP_010100885.1| hypothetical protein L484_009655 [Morus notabilis] gi|587897335|gb|EXB85809.1| hypothetical protein L484_009655 [Morus notabilis] Length = 879 Score = 73.2 bits (178), Expect = 7e-11 Identities = 36/57 (63%), Positives = 44/57 (77%), Gaps = 6/57 (10%) Frame = -3 Query: 347 WIEVEDKVHAFLVWDKAHPKCEEMYEKLGLLIGEMKPDGYAM------DVDYEEAEE 195 WIEV+D+VHAFLV DKAHP+C E+YEKL LL+GEMK GY++ DV+ EE EE Sbjct: 819 WIEVKDEVHAFLVGDKAHPRCIEIYEKLHLLVGEMKWAGYSLYAHFDEDVEVEEQEE 875 >ref|XP_006384245.1| hypothetical protein POPTR_0004s11010g [Populus trichocarpa] gi|550340791|gb|ERP62042.1| hypothetical protein POPTR_0004s11010g [Populus trichocarpa] Length = 897 Score = 69.3 bits (168), Expect = 1e-09 Identities = 34/54 (62%), Positives = 41/54 (75%), Gaps = 3/54 (5%) Frame = -3 Query: 347 WIEVEDKVHAFLVWDKAHPKCEEMYEKLGLLIGEMKPDGYAMDVDY---EEAEE 195 WIE++D+VHAFLV DK HP+ EE+YEKLG+LIGEM+ GY D D EE EE Sbjct: 827 WIELKDEVHAFLVGDKGHPRDEEIYEKLGVLIGEMQSVGYIPDCDVLLDEEVEE 880 >ref|XP_007217021.1| hypothetical protein PRUPE_ppa001933mg [Prunus persica] gi|462413171|gb|EMJ18220.1| hypothetical protein PRUPE_ppa001933mg [Prunus persica] Length = 739 Score = 69.3 bits (168), Expect = 1e-09 Identities = 33/56 (58%), Positives = 41/56 (73%), Gaps = 3/56 (5%) Frame = -3 Query: 347 WIEVEDKVHAFLVWDKAHPKCEEMYEKLGLLIGEMKPDGYAMDVDY---EEAEESE 189 WIEV+D++HAFLV DKAHP+C E+YEKL LL+ EM GY ++D EE EE E Sbjct: 672 WIEVKDELHAFLVGDKAHPRCNEVYEKLDLLVAEMMRVGYRPEIDALLDEEMEEQE 727 >ref|XP_007032935.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] gi|508711964|gb|EOY03861.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] Length = 860 Score = 68.9 bits (167), Expect = 1e-09 Identities = 31/52 (59%), Positives = 42/52 (80%) Frame = -3 Query: 347 WIEVEDKVHAFLVWDKAHPKCEEMYEKLGLLIGEMKPDGYAMDVDYEEAEES 192 WIEV+D+VHAFLV DKAHP+C+E+YEKLG+L+ EM+ Y D+D+ EE+ Sbjct: 795 WIEVKDEVHAFLVGDKAHPRCKEIYEKLGILVDEMR--CYVADIDFFLEEEA 844 >ref|XP_008244547.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 [Prunus mume] Length = 904 Score = 68.6 bits (166), Expect = 2e-09 Identities = 32/56 (57%), Positives = 40/56 (71%), Gaps = 3/56 (5%) Frame = -3 Query: 347 WIEVEDKVHAFLVWDKAHPKCEEMYEKLGLLIGEMKPDGYAMDVDY---EEAEESE 189 WIEV+D++HAFLV DKAHP+C E+YEKL L+ EM GY ++D EE EE E Sbjct: 837 WIEVKDELHAFLVGDKAHPRCNEVYEKLNFLVAEMMRVGYRPEIDVLLDEEMEEQE 892 >ref|XP_011009905.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 [Populus euphratica] Length = 897 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/54 (61%), Positives = 41/54 (75%), Gaps = 3/54 (5%) Frame = -3 Query: 347 WIEVEDKVHAFLVWDKAHPKCEEMYEKLGLLIGEMKPDGYAMDVDY---EEAEE 195 WIE++D+VHAFLV DK HP+ EE+YE+LG+LIGEM+ GY D D EE EE Sbjct: 827 WIELKDEVHAFLVGDKGHPRHEEIYERLGVLIGEMQSVGYIPDCDVLLDEEVEE 880 >ref|XP_004491978.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 [Cicer arietinum] Length = 880 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 3/54 (5%) Frame = -3 Query: 347 WIEVEDKVHAFLVWDKAHPKCEEMYEKLGLLIGEMKPDGYAMDVDY---EEAEE 195 WIEV D+VHAFLV DKAHP+ EE+Y+ LL+ EMK DGY D+D+ EE +E Sbjct: 811 WIEVRDEVHAFLVGDKAHPRSEEIYQLTHLLVDEMKWDGYVPDIDFLLDEEVDE 864 >ref|XP_014496896.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 [Vigna radiata var. radiata] Length = 889 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/56 (55%), Positives = 40/56 (71%), Gaps = 3/56 (5%) Frame = -3 Query: 347 WIEVEDKVHAFLVWDKAHPKCEEMYEKLGLLIGEMKPDGYAMDVDY---EEAEESE 189 WIE+ D+VH FLV DKAHP+ EE+YEK+ LL+ EM GY D+D+ EE EE + Sbjct: 821 WIEIRDEVHTFLVGDKAHPRSEEIYEKIHLLVDEMNWAGYVPDIDFLLDEEVEEHD 876 >ref|XP_003551787.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330-like [Glycine max] gi|947051913|gb|KRH01442.1| hypothetical protein GLYMA_18G277000 [Glycine max] Length = 852 Score = 67.4 bits (163), Expect = 4e-09 Identities = 32/55 (58%), Positives = 39/55 (70%) Frame = -3 Query: 347 WIEVEDKVHAFLVWDKAHPKCEEMYEKLGLLIGEMKPDGYAMDVDYEEAEESE*Q 183 WIEV D+VH FLV DKAHP+ EE+YE+ LL+ EMK GY D+D+ EE E Q Sbjct: 784 WIEVRDEVHTFLVGDKAHPRSEEIYEQTHLLVDEMKWAGYVPDIDFMLDEEMEEQ 838 >gb|KHN13782.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 711 Score = 66.6 bits (161), Expect = 7e-09 Identities = 30/53 (56%), Positives = 38/53 (71%) Frame = -3 Query: 347 WIEVEDKVHAFLVWDKAHPKCEEMYEKLGLLIGEMKPDGYAMDVDYEEAEESE 189 WIE+ D+VH FLV DKAHP+ EE+YE+ LL+ EMK GY D+D+ EE E Sbjct: 656 WIEIRDEVHTFLVGDKAHPRSEEIYEQTHLLVDEMKWAGYVPDIDFMLDEEME 708 >ref|XP_009373813.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 [Pyrus x bretschneideri] Length = 892 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/51 (58%), Positives = 39/51 (76%) Frame = -3 Query: 347 WIEVEDKVHAFLVWDKAHPKCEEMYEKLGLLIGEMKPDGYAMDVDYEEAEE 195 WIEV+D+VHAFLV DKAHP+ +E+YEKL LL+ EM GY ++D+ EE Sbjct: 827 WIEVKDEVHAFLVGDKAHPRHKEVYEKLDLLVSEMTRVGYRPEIDFVLEEE 877 >gb|KHN14453.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 796 Score = 65.5 bits (158), Expect = 2e-08 Identities = 32/56 (57%), Positives = 39/56 (69%), Gaps = 3/56 (5%) Frame = -3 Query: 347 WIEVEDKVHAFLVWDKAHPKCEEMYEKLGLLIGEMKPDGYAMDVDY---EEAEESE 189 WIEV D+VH FLV DKAHP+ EE+YE+ LL+ EMK GY D+D EE EE + Sbjct: 728 WIEVRDEVHTFLVGDKAHPRSEEIYEQTHLLVDEMKWAGYVPDIDSMLDEEVEEQD 783 >ref|XP_003530462.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330-like [Glycine max] gi|947096574|gb|KRH45159.1| hypothetical protein GLYMA_08G254300 [Glycine max] Length = 852 Score = 65.5 bits (158), Expect = 2e-08 Identities = 32/56 (57%), Positives = 39/56 (69%), Gaps = 3/56 (5%) Frame = -3 Query: 347 WIEVEDKVHAFLVWDKAHPKCEEMYEKLGLLIGEMKPDGYAMDVDY---EEAEESE 189 WIEV D+VH FLV DKAHP+ EE+YE+ LL+ EMK GY D+D EE EE + Sbjct: 784 WIEVRDEVHTFLVGDKAHPRSEEIYEQTHLLVDEMKWAGYVPDIDSMLDEEVEEQD 839 >gb|KOM27023.1| hypothetical protein LR48_Vigan358s000100 [Vigna angularis] Length = 686 Score = 64.7 bits (156), Expect = 3e-08 Identities = 30/56 (53%), Positives = 40/56 (71%), Gaps = 3/56 (5%) Frame = -3 Query: 347 WIEVEDKVHAFLVWDKAHPKCEEMYEKLGLLIGEMKPDGYAMDVDY---EEAEESE 189 WIE+ D+VH FLV DKAHP+ E +YE++ LL+ EMK GY D+D+ EE EE + Sbjct: 618 WIEIRDEVHTFLVRDKAHPRYEVIYEQIHLLVDEMKWAGYVPDIDFLLDEEVEEQD 673 >ref|XP_011658918.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 isoform X3 [Cucumis sativus] Length = 784 Score = 64.7 bits (156), Expect = 3e-08 Identities = 31/56 (55%), Positives = 39/56 (69%) Frame = -3 Query: 347 WIEVEDKVHAFLVWDKAHPKCEEMYEKLGLLIGEMKPDGYAMDVDYEEAEESE*QR 180 WIEV+D+VH FLV DKAHPKCE +Y L LLI +M+ G A ++D + EE E R Sbjct: 719 WIEVKDEVHTFLVCDKAHPKCEMIYSLLDLLICDMRRSGCAPEIDTIQVEEVEENR 774