BLASTX nr result
ID: Zanthoxylum22_contig00041277
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00041277 (530 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO75477.1| hypothetical protein CISIN_1g004229mg [Citrus sin... 89 2e-15 ref|XP_006468020.1| PREDICTED: zinc finger MYND domain-containin... 89 2e-15 ref|XP_006449041.1| hypothetical protein CICLE_v10017921mg [Citr... 89 2e-15 ref|XP_008384065.1| PREDICTED: zinc finger MYND domain-containin... 87 6e-15 emb|CBI33265.3| unnamed protein product [Vitis vinifera] 86 1e-14 ref|XP_002266891.1| PREDICTED: zinc finger MYND domain-containin... 86 1e-14 ref|XP_009357432.1| PREDICTED: zinc finger MYND domain-containin... 86 1e-14 ref|XP_010101441.1| Zinc finger MYND domain-containing protein 1... 85 2e-14 ref|XP_002518500.1| hypothetical protein RCOM_0905090 [Ricinus c... 85 2e-14 ref|XP_009345542.1| PREDICTED: zinc finger MYND domain-containin... 84 4e-14 ref|XP_009362427.1| PREDICTED: zinc finger MYND domain-containin... 84 4e-14 ref|XP_008371103.1| PREDICTED: zinc finger MYND domain-containin... 83 7e-14 ref|XP_011048009.1| PREDICTED: zinc finger MYND domain-containin... 83 9e-14 ref|XP_006389643.1| hypothetical protein POPTR_0021s00930g [Popu... 83 9e-14 ref|XP_006594430.1| PREDICTED: zinc finger MYND domain-containin... 82 2e-13 ref|XP_008224809.1| PREDICTED: zinc finger MYND domain-containin... 81 3e-13 ref|XP_012091370.1| PREDICTED: zinc finger MYND domain-containin... 81 3e-13 ref|XP_014518981.1| PREDICTED: zinc finger MYND domain-containin... 80 5e-13 gb|KOM53432.1| hypothetical protein LR48_Vigan09g209100 [Vigna a... 80 5e-13 ref|XP_004293277.1| PREDICTED: zinc finger MYND domain-containin... 80 5e-13 >gb|KDO75477.1| hypothetical protein CISIN_1g004229mg [Citrus sinensis] Length = 766 Score = 88.6 bits (218), Expect = 2e-15 Identities = 45/50 (90%), Positives = 45/50 (90%), Gaps = 4/50 (8%) Frame = +3 Query: 393 MDLHLKNLFGRFQ----SGPGLGPGSGTCLMKVEGIAPNYIKSIYRAAAA 530 MDLHLKNLFGRFQ SGPGLGPGSGTCLMKVEGIAPN IKSIYRAAAA Sbjct: 1 MDLHLKNLFGRFQDQFGSGPGLGPGSGTCLMKVEGIAPNCIKSIYRAAAA 50 >ref|XP_006468020.1| PREDICTED: zinc finger MYND domain-containing protein 15-like [Citrus sinensis] Length = 632 Score = 88.6 bits (218), Expect = 2e-15 Identities = 45/50 (90%), Positives = 45/50 (90%), Gaps = 4/50 (8%) Frame = +3 Query: 393 MDLHLKNLFGRFQ----SGPGLGPGSGTCLMKVEGIAPNYIKSIYRAAAA 530 MDLHLKNLFGRFQ SGPGLGPGSGTCLMKVEGIAPN IKSIYRAAAA Sbjct: 1 MDLHLKNLFGRFQDQFGSGPGLGPGSGTCLMKVEGIAPNCIKSIYRAAAA 50 >ref|XP_006449041.1| hypothetical protein CICLE_v10017921mg [Citrus clementina] gi|557551652|gb|ESR62281.1| hypothetical protein CICLE_v10017921mg [Citrus clementina] Length = 594 Score = 88.6 bits (218), Expect = 2e-15 Identities = 45/50 (90%), Positives = 45/50 (90%), Gaps = 4/50 (8%) Frame = +3 Query: 393 MDLHLKNLFGRFQ----SGPGLGPGSGTCLMKVEGIAPNYIKSIYRAAAA 530 MDLHLKNLFGRFQ SGPGLGPGSGTCLMKVEGIAPN IKSIYRAAAA Sbjct: 1 MDLHLKNLFGRFQDQFGSGPGLGPGSGTCLMKVEGIAPNCIKSIYRAAAA 50 >ref|XP_008384065.1| PREDICTED: zinc finger MYND domain-containing protein 15-like [Malus domestica] Length = 632 Score = 86.7 bits (213), Expect = 6e-15 Identities = 42/50 (84%), Positives = 45/50 (90%), Gaps = 4/50 (8%) Frame = +3 Query: 393 MDLHLKNLFGRFQS----GPGLGPGSGTCLMKVEGIAPNYIKSIYRAAAA 530 MDLHLKNLFGRFQ GPGLGPGSGTCLMKVEGIAPN+IKSIY+A+AA Sbjct: 1 MDLHLKNLFGRFQEQFGXGPGLGPGSGTCLMKVEGIAPNFIKSIYKASAA 50 >emb|CBI33265.3| unnamed protein product [Vitis vinifera] Length = 395 Score = 85.9 bits (211), Expect = 1e-14 Identities = 43/50 (86%), Positives = 45/50 (90%), Gaps = 4/50 (8%) Frame = +3 Query: 393 MDLHLKNLFGRFQ----SGPGLGPGSGTCLMKVEGIAPNYIKSIYRAAAA 530 MDLHLKNLFGRFQ SGPGLGPGSGTCLMKVEGIAP +IKSI+RAAAA Sbjct: 1 MDLHLKNLFGRFQEQFGSGPGLGPGSGTCLMKVEGIAPAFIKSIFRAAAA 50 >ref|XP_002266891.1| PREDICTED: zinc finger MYND domain-containing protein 15 [Vitis vinifera] Length = 633 Score = 85.9 bits (211), Expect = 1e-14 Identities = 43/50 (86%), Positives = 45/50 (90%), Gaps = 4/50 (8%) Frame = +3 Query: 393 MDLHLKNLFGRFQ----SGPGLGPGSGTCLMKVEGIAPNYIKSIYRAAAA 530 MDLHLKNLFGRFQ SGPGLGPGSGTCLMKVEGIAP +IKSI+RAAAA Sbjct: 1 MDLHLKNLFGRFQEQFGSGPGLGPGSGTCLMKVEGIAPAFIKSIFRAAAA 50 >ref|XP_009357432.1| PREDICTED: zinc finger MYND domain-containing protein 15 [Pyrus x bretschneideri] gi|694351088|ref|XP_009357433.1| PREDICTED: zinc finger MYND domain-containing protein 15 [Pyrus x bretschneideri] gi|694351092|ref|XP_009357434.1| PREDICTED: zinc finger MYND domain-containing protein 15 [Pyrus x bretschneideri] Length = 632 Score = 85.5 bits (210), Expect = 1e-14 Identities = 42/50 (84%), Positives = 45/50 (90%), Gaps = 4/50 (8%) Frame = +3 Query: 393 MDLHLKNLFGRFQ----SGPGLGPGSGTCLMKVEGIAPNYIKSIYRAAAA 530 MDLHLKNLF RFQ SGPGLGPGSGTCLMKVEGIAPN+IKSIY+A+AA Sbjct: 1 MDLHLKNLFDRFQEQFGSGPGLGPGSGTCLMKVEGIAPNFIKSIYKASAA 50 >ref|XP_010101441.1| Zinc finger MYND domain-containing protein 15 [Morus notabilis] gi|703150157|ref|XP_010109787.1| Zinc finger MYND domain-containing protein 15 [Morus notabilis] gi|587900077|gb|EXB88424.1| Zinc finger MYND domain-containing protein 15 [Morus notabilis] gi|587972995|gb|EXC57838.1| Zinc finger MYND domain-containing protein 15 [Morus notabilis] Length = 632 Score = 85.1 bits (209), Expect = 2e-14 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 4/50 (8%) Frame = +3 Query: 393 MDLHLKNLFGRFQ----SGPGLGPGSGTCLMKVEGIAPNYIKSIYRAAAA 530 MDLHLK+LFGRFQ SGPGLGPGSGTCLMKVEG+APN+IKS+++AAAA Sbjct: 1 MDLHLKSLFGRFQEQFGSGPGLGPGSGTCLMKVEGVAPNFIKSVFKAAAA 50 >ref|XP_002518500.1| hypothetical protein RCOM_0905090 [Ricinus communis] gi|223542345|gb|EEF43887.1| hypothetical protein RCOM_0905090 [Ricinus communis] Length = 632 Score = 85.1 bits (209), Expect = 2e-14 Identities = 41/50 (82%), Positives = 45/50 (90%), Gaps = 4/50 (8%) Frame = +3 Query: 393 MDLHLKNLFGRFQ----SGPGLGPGSGTCLMKVEGIAPNYIKSIYRAAAA 530 MDLHLK+LFGRFQ SGPGLGPGSGTCLMKVEGIAPN+IKS+Y+A AA Sbjct: 1 MDLHLKSLFGRFQEQFGSGPGLGPGSGTCLMKVEGIAPNFIKSLYKACAA 50 >ref|XP_009345542.1| PREDICTED: zinc finger MYND domain-containing protein 15-like [Pyrus x bretschneideri] Length = 632 Score = 84.0 bits (206), Expect = 4e-14 Identities = 41/50 (82%), Positives = 45/50 (90%), Gaps = 4/50 (8%) Frame = +3 Query: 393 MDLHLKNLFGRFQ----SGPGLGPGSGTCLMKVEGIAPNYIKSIYRAAAA 530 MDLHLKNLF RFQ SGPGLGPGSGTCLMKVEGIAPN+IKSI++A+AA Sbjct: 1 MDLHLKNLFDRFQEQFGSGPGLGPGSGTCLMKVEGIAPNFIKSIFKASAA 50 >ref|XP_009362427.1| PREDICTED: zinc finger MYND domain-containing protein 15-like [Pyrus x bretschneideri] Length = 632 Score = 84.0 bits (206), Expect = 4e-14 Identities = 41/50 (82%), Positives = 45/50 (90%), Gaps = 4/50 (8%) Frame = +3 Query: 393 MDLHLKNLFGRFQ----SGPGLGPGSGTCLMKVEGIAPNYIKSIYRAAAA 530 MDLHLKNLF RFQ SGPGLGPGSGTCLMKVEGIAPN+IKSI++A+AA Sbjct: 1 MDLHLKNLFDRFQEQFGSGPGLGPGSGTCLMKVEGIAPNFIKSIFKASAA 50 >ref|XP_008371103.1| PREDICTED: zinc finger MYND domain-containing protein 15-like [Malus domestica] Length = 632 Score = 83.2 bits (204), Expect = 7e-14 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 4/50 (8%) Frame = +3 Query: 393 MDLHLKNLFGRFQ----SGPGLGPGSGTCLMKVEGIAPNYIKSIYRAAAA 530 MDLHLKNLF RFQ SGPGLGPGSGTCLMKVEGIAPN+IKS+++A+AA Sbjct: 1 MDLHLKNLFDRFQEQFGSGPGLGPGSGTCLMKVEGIAPNFIKSLFKASAA 50 >ref|XP_011048009.1| PREDICTED: zinc finger MYND domain-containing protein 15 isoform X1 [Populus euphratica] Length = 631 Score = 82.8 bits (203), Expect = 9e-14 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 4/50 (8%) Frame = +3 Query: 393 MDLHLKNLFGRFQ----SGPGLGPGSGTCLMKVEGIAPNYIKSIYRAAAA 530 MDLHLKNLFGRFQ SGPGLGPGS TCLMKVEG++PN+IKSIY+ +AA Sbjct: 1 MDLHLKNLFGRFQEQFGSGPGLGPGSSTCLMKVEGVSPNFIKSIYKGSAA 50 >ref|XP_006389643.1| hypothetical protein POPTR_0021s00930g [Populus trichocarpa] gi|550312472|gb|ERP48557.1| hypothetical protein POPTR_0021s00930g [Populus trichocarpa] Length = 604 Score = 82.8 bits (203), Expect = 9e-14 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 4/50 (8%) Frame = +3 Query: 393 MDLHLKNLFGRFQ----SGPGLGPGSGTCLMKVEGIAPNYIKSIYRAAAA 530 MDLHLKNLFGRFQ SGPGLGPGS TCLMKVEG++PN+IKSIY+ +AA Sbjct: 1 MDLHLKNLFGRFQEQFGSGPGLGPGSSTCLMKVEGVSPNFIKSIYKGSAA 50 >ref|XP_006594430.1| PREDICTED: zinc finger MYND domain-containing protein 15-like [Glycine max] gi|947071978|gb|KRH20869.1| hypothetical protein GLYMA_13G205700 [Glycine max] Length = 631 Score = 81.6 bits (200), Expect = 2e-13 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 4/50 (8%) Frame = +3 Query: 393 MDLHLKNLFGRFQ----SGPGLGPGSGTCLMKVEGIAPNYIKSIYRAAAA 530 MDLHLK+LF RFQ SGPGLGPGSGTC+MKV+GIAPN+IKSIY+A+AA Sbjct: 1 MDLHLKSLFDRFQEQFGSGPGLGPGSGTCMMKVDGIAPNFIKSIYKASAA 50 >ref|XP_008224809.1| PREDICTED: zinc finger MYND domain-containing protein 15 [Prunus mume] Length = 632 Score = 81.3 bits (199), Expect = 3e-13 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 4/50 (8%) Frame = +3 Query: 393 MDLHLKNLFGRFQ----SGPGLGPGSGTCLMKVEGIAPNYIKSIYRAAAA 530 MDLHLKN+F RFQ SGPGLGPGSGTCLMKVEGI+PN+IKS+++A+AA Sbjct: 1 MDLHLKNVFDRFQEQFGSGPGLGPGSGTCLMKVEGISPNFIKSVFKASAA 50 >ref|XP_012091370.1| PREDICTED: zinc finger MYND domain-containing protein 15 [Jatropha curcas] gi|643703699|gb|KDP20763.1| hypothetical protein JCGZ_21234 [Jatropha curcas] Length = 636 Score = 81.3 bits (199), Expect = 3e-13 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 4/50 (8%) Frame = +3 Query: 393 MDLHLKNLFGRFQ----SGPGLGPGSGTCLMKVEGIAPNYIKSIYRAAAA 530 MD+HLK+LFGRFQ SGPGLGPGSGTCLMKVEGI+PN IKS+Y+A AA Sbjct: 1 MDMHLKSLFGRFQEQFGSGPGLGPGSGTCLMKVEGISPNLIKSMYKACAA 50 >ref|XP_014518981.1| PREDICTED: zinc finger MYND domain-containing protein 15 [Vigna radiata var. radiata] Length = 631 Score = 80.5 bits (197), Expect = 5e-13 Identities = 37/50 (74%), Positives = 45/50 (90%), Gaps = 4/50 (8%) Frame = +3 Query: 393 MDLHLKNLFGRFQ----SGPGLGPGSGTCLMKVEGIAPNYIKSIYRAAAA 530 MDLHLK+LF RFQ SGPGLGPGSGTC+M+V+GIAPN+IKS+Y+A+AA Sbjct: 1 MDLHLKSLFNRFQEQFGSGPGLGPGSGTCMMRVDGIAPNFIKSVYKASAA 50 >gb|KOM53432.1| hypothetical protein LR48_Vigan09g209100 [Vigna angularis] Length = 611 Score = 80.5 bits (197), Expect = 5e-13 Identities = 37/50 (74%), Positives = 45/50 (90%), Gaps = 4/50 (8%) Frame = +3 Query: 393 MDLHLKNLFGRFQ----SGPGLGPGSGTCLMKVEGIAPNYIKSIYRAAAA 530 MDLHLK+LF RFQ SGPGLGPGSGTC+M+V+GIAPN+IKS+Y+A+AA Sbjct: 1 MDLHLKSLFNRFQEQFGSGPGLGPGSGTCMMRVDGIAPNFIKSVYKASAA 50 >ref|XP_004293277.1| PREDICTED: zinc finger MYND domain-containing protein 15 [Fragaria vesca subsp. vesca] Length = 631 Score = 80.5 bits (197), Expect = 5e-13 Identities = 40/50 (80%), Positives = 43/50 (86%), Gaps = 4/50 (8%) Frame = +3 Query: 393 MDLHLKNLFGRFQ----SGPGLGPGSGTCLMKVEGIAPNYIKSIYRAAAA 530 MDLHLKNLF RFQ +GPGLGPGSGTCLM VEGIAPN IKS++RAAAA Sbjct: 1 MDLHLKNLFDRFQEQFGTGPGLGPGSGTCLMNVEGIAPNIIKSMFRAAAA 50