BLASTX nr result
ID: Zanthoxylum22_contig00041079
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00041079 (368 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006426522.1| hypothetical protein CICLE_v10026551mg [Citr... 49 7e-08 ref|XP_006466043.1| PREDICTED: uncharacterized protein LOC102609... 49 3e-07 >ref|XP_006426522.1| hypothetical protein CICLE_v10026551mg [Citrus clementina] gi|557528512|gb|ESR39762.1| hypothetical protein CICLE_v10026551mg [Citrus clementina] gi|641846404|gb|KDO65288.1| hypothetical protein CISIN_1g029486mg [Citrus sinensis] Length = 192 Score = 49.3 bits (116), Expect(3) = 7e-08 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -3 Query: 150 P*TSPPITVVAKLREPSPVNQQRELFKWAL 61 P SPPIT AKL EP PVNQQRELFKW L Sbjct: 127 PLPSPPITEAAKLHEPIPVNQQRELFKWIL 156 Score = 32.0 bits (71), Expect(3) = 7e-08 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = -2 Query: 256 MRTKGKDTSISEEEE 212 MRTKGKDTSI+EEEE Sbjct: 91 MRTKGKDTSITEEEE 105 Score = 21.2 bits (43), Expect(3) = 7e-08 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -1 Query: 302 LQVPANLAIVAYFF 261 L + ANLA+ AYFF Sbjct: 77 LLLTANLAVGAYFF 90 >ref|XP_006466043.1| PREDICTED: uncharacterized protein LOC102609690 [Citrus sinensis] Length = 192 Score = 49.3 bits (116), Expect(3) = 3e-07 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -3 Query: 150 P*TSPPITVVAKLREPSPVNQQRELFKWAL 61 P SPPIT AKL EP PVNQQRELFKW L Sbjct: 127 PLPSPPITEAAKLHEPIPVNQQRELFKWIL 156 Score = 30.0 bits (66), Expect(3) = 3e-07 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -2 Query: 256 MRTKGKDTSISEEE 215 MRTKGKDTSI+EEE Sbjct: 91 MRTKGKDTSITEEE 104 Score = 21.2 bits (43), Expect(3) = 3e-07 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -1 Query: 302 LQVPANLAIVAYFF 261 L + ANLA+ AYFF Sbjct: 77 LLLTANLAVGAYFF 90