BLASTX nr result
ID: Zanthoxylum22_contig00041014
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00041014 (345 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012759827.1| hypothetical protein SAMD00019534_034810 [Ac... 60 8e-07 >ref|XP_012759827.1| hypothetical protein SAMD00019534_034810 [Acytostelium subglobosum LB1] gi|735994617|dbj|GAM20306.1| hypothetical protein SAMD00019534_034810 [Acytostelium subglobosum LB1] Length = 396 Score = 59.7 bits (143), Expect = 8e-07 Identities = 35/96 (36%), Positives = 50/96 (52%), Gaps = 4/96 (4%) Frame = -1 Query: 285 EDVSLASMFGPFVKNYTNCLAHGQPVSRMPYPINFYYPNSSLQLQAEIQMKHVNLLLNAN 106 E VS S+ F+K L+ G +S MP P +F P S+L AE H ++LL AN Sbjct: 43 ESVSRTSVMASFIKK----LSFGADLSVMPVPASFILPKSTLSYFAEHYSNHFDILLQAN 98 Query: 105 AQQSPLARFMCVVQYALSTCSL----TKFPYKPIIG 10 P RF+ V +Y ++TC L T+ P P++G Sbjct: 99 EITDPTERFLQVAKYMMTTCLLPEDPTRKPLNPVLG 134