BLASTX nr result
ID: Zanthoxylum22_contig00040443
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00040443 (842 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAO46748.1| hypothetical protein G7K_0970-t1 [Saitoella comp... 59 6e-06 >dbj|GAO46748.1| hypothetical protein G7K_0970-t1 [Saitoella complicata NRRL Y-17804] Length = 1184 Score = 58.5 bits (140), Expect = 6e-06 Identities = 28/65 (43%), Positives = 37/65 (56%), Gaps = 2/65 (3%) Frame = -1 Query: 842 SQACCNDSVNGISCYNPSQYSC--PSYNGNSYRLCPLGNGACNGNCYQKNKYICTSAGTL 669 S +CC + NG CYNPS Y+C + + LC G ACNG C+ +KY C GTL Sbjct: 562 SNSCCPSTSNGQQCYNPSVYTCIFETSSTGKVTLCSFGMDACNGGCFDPSKYRC-EGGTL 620 Query: 668 QQYSA 654 +Q +A Sbjct: 621 KQGAA 625