BLASTX nr result
ID: Zanthoxylum22_contig00040308
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00040308 (715 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB60706.1| hypothetical protein B456_009G321000 [Gossypium r... 55 7e-06 >gb|KJB60706.1| hypothetical protein B456_009G321000 [Gossypium raimondii] Length = 75 Score = 55.1 bits (131), Expect(2) = 7e-06 Identities = 30/45 (66%), Positives = 33/45 (73%), Gaps = 2/45 (4%) Frame = -3 Query: 131 NRRKNVEPRA--HLYKIENGGCKSTADHVLQVARCFLPHRFKRSF 3 NR K+VE +A LY + STADHVLQVARCFLPHRFKRSF Sbjct: 26 NRTKDVEQKAPSFLYNGKWWVLTSTADHVLQVARCFLPHRFKRSF 70 Score = 22.7 bits (47), Expect(2) = 7e-06 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -1 Query: 166 HYHPPKGEDSNRTEE 122 HY+P K D NRT++ Sbjct: 16 HYNPKKKTDYNRTKD 30