BLASTX nr result
ID: Zanthoxylum22_contig00039981
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00039981 (375 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006435633.1| hypothetical protein CICLE_v10032034mg [Citr... 60 5e-07 gb|KNA11599.1| hypothetical protein SOVF_133730 [Spinacia oleracea] 57 4e-06 >ref|XP_006435633.1| hypothetical protein CICLE_v10032034mg [Citrus clementina] gi|568866102|ref|XP_006486403.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Citrus sinensis] gi|557537829|gb|ESR48873.1| hypothetical protein CICLE_v10032034mg [Citrus clementina] Length = 338 Score = 60.5 bits (145), Expect = 5e-07 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = -3 Query: 370 TMPMPMPVHSLPPNLLPNGQMPHDVFWGXXXXXXPFN 260 T MPMP+++LPPNL+PNGQMPHDVFWG PFN Sbjct: 302 TTTMPMPIYNLPPNLMPNGQMPHDVFWGPPPRPPPFN 338 >gb|KNA11599.1| hypothetical protein SOVF_133730 [Spinacia oleracea] Length = 332 Score = 57.4 bits (137), Expect = 4e-06 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = -3 Query: 373 TTMPMPMPVHSLPPNLLPNGQMPHDVFWG 287 +T MPMP+ +LPPNLLPNGQMPHD+FWG Sbjct: 295 STSSMPMPIFNLPPNLLPNGQMPHDMFWG 323