BLASTX nr result
ID: Zanthoxylum22_contig00039773
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00039773 (508 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO71812.1| hypothetical protein CISIN_1g038180mg, partial [C... 69 1e-09 ref|XP_006488894.1| PREDICTED: uncharacterized protein LOC102608... 69 1e-09 ref|XP_006419456.1| hypothetical protein CICLE_v10005076mg [Citr... 69 1e-09 ref|XP_012484559.1| PREDICTED: uncharacterized protein LOC105798... 62 1e-07 gb|KHG10354.1| hypothetical protein F383_15127 [Gossypium arboreum] 62 1e-07 ref|XP_010259425.1| PREDICTED: uncharacterized protein LOC104598... 62 2e-07 ref|XP_009777966.1| PREDICTED: uncharacterized protein LOC104227... 61 3e-07 ref|XP_009777965.1| PREDICTED: uncharacterized protein LOC104227... 61 3e-07 ref|XP_009777964.1| PREDICTED: uncharacterized protein LOC104227... 61 3e-07 ref|XP_009595846.1| PREDICTED: uncharacterized protein LOC104092... 61 3e-07 ref|XP_009595842.1| PREDICTED: uncharacterized protein LOC104092... 61 3e-07 ref|XP_010649548.1| PREDICTED: uncharacterized protein LOC100258... 61 4e-07 ref|XP_010649549.1| PREDICTED: mediator of RNA polymerase II tra... 61 4e-07 emb|CBI22929.3| unnamed protein product [Vitis vinifera] 61 4e-07 ref|XP_007035708.1| Uncharacterized protein TCM_021297 [Theobrom... 61 4e-07 ref|XP_003620403.2| DUF789 family protein [Medicago truncatula] ... 60 6e-07 ref|XP_006363577.1| PREDICTED: uncharacterized protein LOC102606... 60 8e-07 ref|XP_004229279.1| PREDICTED: uncharacterized protein LOC101266... 60 8e-07 ref|XP_003534161.1| PREDICTED: uncharacterized protein LOC100775... 59 1e-06 ref|XP_002519172.1| conserved hypothetical protein [Ricinus comm... 58 3e-06 >gb|KDO71812.1| hypothetical protein CISIN_1g038180mg, partial [Citrus sinensis] Length = 406 Score = 69.3 bits (168), Expect = 1e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 506 ANSLLQAADNWLKLLQVSHPDYKFFASHNSYMR 408 ANSLL+AADNWLKLLQVSHPDYKFF SHNSYMR Sbjct: 374 ANSLLRAADNWLKLLQVSHPDYKFFVSHNSYMR 406 >ref|XP_006488894.1| PREDICTED: uncharacterized protein LOC102608954 [Citrus sinensis] Length = 411 Score = 69.3 bits (168), Expect = 1e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 506 ANSLLQAADNWLKLLQVSHPDYKFFASHNSYMR 408 ANSLL+AADNWLKLLQVSHPDYKFF SHNSYMR Sbjct: 379 ANSLLRAADNWLKLLQVSHPDYKFFVSHNSYMR 411 >ref|XP_006419456.1| hypothetical protein CICLE_v10005076mg [Citrus clementina] gi|557521329|gb|ESR32696.1| hypothetical protein CICLE_v10005076mg [Citrus clementina] Length = 411 Score = 69.3 bits (168), Expect = 1e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 506 ANSLLQAADNWLKLLQVSHPDYKFFASHNSYMR 408 ANSLL+AADNWLKLLQVSHPDYKFF SHNSYMR Sbjct: 379 ANSLLRAADNWLKLLQVSHPDYKFFVSHNSYMR 411 >ref|XP_012484559.1| PREDICTED: uncharacterized protein LOC105798874 [Gossypium raimondii] gi|763767462|gb|KJB34677.1| hypothetical protein B456_006G077900 [Gossypium raimondii] Length = 429 Score = 62.4 bits (150), Expect = 1e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -3 Query: 506 ANSLLQAADNWLKLLQVSHPDYKFFASHNSYMR 408 ANSLLQAADNWL+LLQV+HPD++FF SHN+Y R Sbjct: 397 ANSLLQAADNWLRLLQVNHPDFRFFVSHNTYWR 429 >gb|KHG10354.1| hypothetical protein F383_15127 [Gossypium arboreum] Length = 433 Score = 62.4 bits (150), Expect = 1e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -3 Query: 506 ANSLLQAADNWLKLLQVSHPDYKFFASHNSYMR 408 ANSLLQAADNWL+LLQV+HPD++FF SHN+Y R Sbjct: 401 ANSLLQAADNWLRLLQVNHPDFRFFVSHNTYWR 433 >ref|XP_010259425.1| PREDICTED: uncharacterized protein LOC104598865 [Nelumbo nucifera] Length = 404 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 506 ANSLLQAADNWLKLLQVSHPDYKFFASHNSYMR 408 A+SLLQAADNWL+LLQV HPDY+FF SHN+Y R Sbjct: 372 ASSLLQAADNWLRLLQVDHPDYRFFVSHNTYRR 404 >ref|XP_009777966.1| PREDICTED: uncharacterized protein LOC104227420 isoform X3 [Nicotiana sylvestris] Length = 381 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 503 NSLLQAADNWLKLLQVSHPDYKFFASHNSYMR 408 NSLL+AADNWL+LLQV+HPDY FF SHNSY R Sbjct: 350 NSLLRAADNWLRLLQVNHPDYSFFVSHNSYRR 381 >ref|XP_009777965.1| PREDICTED: uncharacterized protein LOC104227420 isoform X2 [Nicotiana sylvestris] Length = 390 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 503 NSLLQAADNWLKLLQVSHPDYKFFASHNSYMR 408 NSLL+AADNWL+LLQV+HPDY FF SHNSY R Sbjct: 359 NSLLRAADNWLRLLQVNHPDYSFFVSHNSYRR 390 >ref|XP_009777964.1| PREDICTED: uncharacterized protein LOC104227420 isoform X1 [Nicotiana sylvestris] Length = 393 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 503 NSLLQAADNWLKLLQVSHPDYKFFASHNSYMR 408 NSLL+AADNWL+LLQV+HPDY FF SHNSY R Sbjct: 362 NSLLRAADNWLRLLQVNHPDYSFFVSHNSYRR 393 >ref|XP_009595846.1| PREDICTED: uncharacterized protein LOC104092058 isoform X2 [Nicotiana tomentosiformis] Length = 379 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 503 NSLLQAADNWLKLLQVSHPDYKFFASHNSYMR 408 NSLL+AADNWL+LLQV+HPDY FF SHNSY R Sbjct: 348 NSLLRAADNWLRLLQVNHPDYSFFVSHNSYRR 379 >ref|XP_009595842.1| PREDICTED: uncharacterized protein LOC104092058 isoform X1 [Nicotiana tomentosiformis] Length = 391 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 503 NSLLQAADNWLKLLQVSHPDYKFFASHNSYMR 408 NSLL+AADNWL+LLQV+HPDY FF SHNSY R Sbjct: 360 NSLLRAADNWLRLLQVNHPDYSFFVSHNSYRR 391 >ref|XP_010649548.1| PREDICTED: uncharacterized protein LOC100258588 isoform X1 [Vitis vinifera] Length = 439 Score = 60.8 bits (146), Expect = 4e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 506 ANSLLQAADNWLKLLQVSHPDYKFFASHNSYMR 408 ANSLL+AADNWL+ LQV+HPDY+FF SHNSY R Sbjct: 407 ANSLLRAADNWLRSLQVNHPDYQFFVSHNSYRR 439 >ref|XP_010649549.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15 isoform X2 [Vitis vinifera] Length = 428 Score = 60.8 bits (146), Expect = 4e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 506 ANSLLQAADNWLKLLQVSHPDYKFFASHNSYMR 408 ANSLL+AADNWL+ LQV+HPDY+FF SHNSY R Sbjct: 396 ANSLLRAADNWLRSLQVNHPDYQFFVSHNSYRR 428 >emb|CBI22929.3| unnamed protein product [Vitis vinifera] Length = 427 Score = 60.8 bits (146), Expect = 4e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 506 ANSLLQAADNWLKLLQVSHPDYKFFASHNSYMR 408 ANSLL+AADNWL+ LQV+HPDY+FF SHNSY R Sbjct: 395 ANSLLRAADNWLRSLQVNHPDYQFFVSHNSYRR 427 >ref|XP_007035708.1| Uncharacterized protein TCM_021297 [Theobroma cacao] gi|508714737|gb|EOY06634.1| Uncharacterized protein TCM_021297 [Theobroma cacao] Length = 423 Score = 60.8 bits (146), Expect = 4e-07 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -3 Query: 506 ANSLLQAADNWLKLLQVSHPDYKFFASHNSYMR 408 ANSLL+AADNWL+LLQV+HPD++FF SHN+Y R Sbjct: 391 ANSLLRAADNWLRLLQVNHPDFRFFVSHNTYWR 423 >ref|XP_003620403.2| DUF789 family protein [Medicago truncatula] gi|657383236|gb|AES76621.2| DUF789 family protein [Medicago truncatula] Length = 401 Score = 60.1 bits (144), Expect = 6e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -3 Query: 506 ANSLLQAADNWLKLLQVSHPDYKFFASHNSYMR 408 ANSLLQAADNWL+L+QV+HPDY+FF SH +Y R Sbjct: 369 ANSLLQAADNWLRLVQVNHPDYQFFVSHGTYRR 401 >ref|XP_006363577.1| PREDICTED: uncharacterized protein LOC102606391 [Solanum tuberosum] Length = 392 Score = 59.7 bits (143), Expect = 8e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -3 Query: 506 ANSLLQAADNWLKLLQVSHPDYKFFASHNSYMR 408 ANSLL+AA NWL+LLQV+HPDY FF SHNSY R Sbjct: 360 ANSLLRAAGNWLRLLQVNHPDYSFFESHNSYRR 392 >ref|XP_004229279.1| PREDICTED: uncharacterized protein LOC101266863 [Solanum lycopersicum] Length = 391 Score = 59.7 bits (143), Expect = 8e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -3 Query: 506 ANSLLQAADNWLKLLQVSHPDYKFFASHNSYMR 408 ANSLL+AA NWL+LLQV+HPDY FF SHNSY R Sbjct: 359 ANSLLRAAGNWLRLLQVNHPDYSFFESHNSYRR 391 >ref|XP_003534161.1| PREDICTED: uncharacterized protein LOC100775751 [Glycine max] gi|734382911|gb|KHN23758.1| hypothetical protein glysoja_033641 [Glycine soja] gi|947090484|gb|KRH39149.1| hypothetical protein GLYMA_09G181300 [Glycine max] Length = 410 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 503 NSLLQAADNWLKLLQVSHPDYKFFASHNSYMR 408 NSLLQAADNWL+LLQV+HPDY+FF SH +Y R Sbjct: 379 NSLLQAADNWLRLLQVNHPDYQFFVSHGTYNR 410 >ref|XP_002519172.1| conserved hypothetical protein [Ricinus communis] gi|223541487|gb|EEF43036.1| conserved hypothetical protein [Ricinus communis] Length = 416 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -3 Query: 503 NSLLQAADNWLKLLQVSHPDYKFFASHNSYMR 408 NSLL+AADNWL+LLQV HPDY FFASHNS R Sbjct: 385 NSLLRAADNWLRLLQVYHPDYMFFASHNSNWR 416