BLASTX nr result
ID: Zanthoxylum22_contig00039752
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00039752 (350 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006446116.1| hypothetical protein CICLE_v10014936mg [Citr... 75 2e-11 ref|XP_002513506.1| DNA-damage-inducible protein f, putative [Ri... 56 9e-06 >ref|XP_006446116.1| hypothetical protein CICLE_v10014936mg [Citrus clementina] gi|568832790|ref|XP_006470609.1| PREDICTED: MATE efflux family protein 1-like [Citrus sinensis] gi|557548727|gb|ESR59356.1| hypothetical protein CICLE_v10014936mg [Citrus clementina] gi|641842353|gb|KDO61259.1| hypothetical protein CISIN_1g010159mg [Citrus sinensis] Length = 516 Score = 75.1 bits (183), Expect = 2e-11 Identities = 39/47 (82%), Positives = 41/47 (87%) Frame = -1 Query: 143 MAEEFGSSGRKKSPPICIFFKDVRNALKLVELGLEITQIALPASLAL 3 MAEEFGS KKSPPI IFFKD+R+ALKL ELGLEI QIALPASLAL Sbjct: 1 MAEEFGSPACKKSPPIFIFFKDIRHALKLDELGLEIAQIALPASLAL 47 >ref|XP_002513506.1| DNA-damage-inducible protein f, putative [Ricinus communis] gi|223547414|gb|EEF48909.1| DNA-damage-inducible protein f, putative [Ricinus communis] Length = 522 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -1 Query: 113 KKSPPICIFFKDVRNALKLVELGLEITQIALPASLAL 3 KK P +CIFF D RN LKL ELGLEI +IALPA+LAL Sbjct: 14 KKRPTVCIFFNDFRNVLKLDELGLEIARIALPAALAL 50