BLASTX nr result
ID: Zanthoxylum22_contig00039710
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00039710 (480 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535465.1| conserved hypothetical protein [Ricinus comm... 71 4e-10 >ref|XP_002535465.1| conserved hypothetical protein [Ricinus communis] gi|223523023|gb|EEF26919.1| conserved hypothetical protein, partial [Ricinus communis] Length = 194 Score = 70.9 bits (172), Expect = 4e-10 Identities = 35/37 (94%), Positives = 35/37 (94%) Frame = -2 Query: 479 SAGRDLLSPALPYRFIHSGTIQLVS*SNSFSIKPFQG 369 SAGRDLLSPALPYRFIHSGTIQLVS SNSF IKPFQG Sbjct: 156 SAGRDLLSPALPYRFIHSGTIQLVSKSNSFYIKPFQG 192