BLASTX nr result
ID: Zanthoxylum22_contig00039621
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00039621 (385 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009045731.1| orf148b (mitochondrion) [Batis maritima] gi|... 79 4e-17 gb|AGC78976.1| hypothetical protein (mitochondrion) [Vicia faba] 59 1e-06 >ref|YP_009045731.1| orf148b (mitochondrion) [Batis maritima] gi|655168505|gb|AIC83334.1| orf148b (mitochondrion) [Batis maritima] Length = 148 Score = 79.0 bits (193), Expect(2) = 4e-17 Identities = 47/70 (67%), Positives = 49/70 (70%), Gaps = 1/70 (1%) Frame = +3 Query: 3 RPSLKWNFHAGARTSMKVDLLQPARLFV-FHFLFTSPS*N*K*KALTELLTESQISLDAE 179 RPSLKWNFHA ARTSMKVDL V F F+ PS + K AL ELLTESQISLD E Sbjct: 34 RPSLKWNFHAEARTSMKVDLFITTSAVVRLSFSFSKPSPSTK--ALAELLTESQISLDTE 91 Query: 180 NFLYVQVDQR 209 NFL QVDQR Sbjct: 92 NFLCAQVDQR 101 Score = 35.4 bits (80), Expect(2) = 4e-17 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = +1 Query: 274 LGHLSRERPPSLRPAVFYF 330 LGH+ +ER PSLRPAVFYF Sbjct: 130 LGHVYQERRPSLRPAVFYF 148 >gb|AGC78976.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 96 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +2 Query: 254 KKRKKRNWAIFPERGRLLSGQQSSTSSRLLYSMTGFPSL 370 +KRKK+NWA+FPE GRLLSGQQSSTSSRLLY G P + Sbjct: 47 QKRKKKNWAMFPEGGRLLSGQQSSTSSRLLYD--GLPCI 83