BLASTX nr result
ID: Zanthoxylum22_contig00039505
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00039505 (279 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007677672.1| hypothetical protein BAUCODRAFT_521236 [Baud... 62 2e-07 ref|XP_013339167.1| hypothetical protein AUEXF2481DRAFT_113245 [... 57 5e-06 gb|KEQ57915.1| alpha/beta-hydrolase [Aureobasidium melanogenum C... 57 5e-06 gb|EME49089.1| hypothetical protein DOTSEDRAFT_40330 [Dothistrom... 56 9e-06 >ref|XP_007677672.1| hypothetical protein BAUCODRAFT_521236 [Baudoinia panamericana UAMH 10762] gi|449298975|gb|EMC94989.1| hypothetical protein BAUCODRAFT_521236 [Baudoinia panamericana UAMH 10762] Length = 301 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -3 Query: 277 DAQLKVVKDGQHFLSFSHPKDVDNALIEFVGKW 179 DA+LKV++ GQHFLSFSHPK+VDNALIEFVGK+ Sbjct: 267 DAKLKVIEGGQHFLSFSHPKEVDNALIEFVGKY 299 >ref|XP_013339167.1| hypothetical protein AUEXF2481DRAFT_113245 [Aureobasidium subglaciale EXF-2481] gi|662533314|gb|KEQ90649.1| hypothetical protein AUEXF2481DRAFT_113245 [Aureobasidium subglaciale EXF-2481] Length = 302 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = -3 Query: 277 DAQLKVVKDGQHFLSFSHPKDVDNALIEFVGKWA 176 DAQLKVV++GQHFLSFSHPK+VD A+ +FV K+A Sbjct: 268 DAQLKVVENGQHFLSFSHPKEVDGAVADFVSKYA 301 >gb|KEQ57915.1| alpha/beta-hydrolase [Aureobasidium melanogenum CBS 110374] Length = 301 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = -3 Query: 277 DAQLKVVKDGQHFLSFSHPKDVDNALIEFVGKWA 176 +AQLKVV+DGQHFLSFSHPK+VD A+ EFV K++ Sbjct: 268 NAQLKVVQDGQHFLSFSHPKEVDGAVAEFVSKYS 301 >gb|EME49089.1| hypothetical protein DOTSEDRAFT_40330 [Dothistroma septosporum NZE10] Length = 298 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -3 Query: 277 DAQLKVVKDGQHFLSFSHPKDVDNALIEFVGKWA 176 DA+L VV+DGQHFLS SHPK+VD ALIEFVGK++ Sbjct: 264 DARLHVVQDGQHFLSSSHPKEVDIALIEFVGKYS 297