BLASTX nr result
ID: Zanthoxylum22_contig00039481
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00039481 (333 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006431996.1| hypothetical protein CICLE_v10001191mg [Citr... 66 1e-08 >ref|XP_006431996.1| hypothetical protein CICLE_v10001191mg [Citrus clementina] gi|568827673|ref|XP_006468174.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 11-like [Citrus sinensis] gi|557534118|gb|ESR45236.1| hypothetical protein CICLE_v10001191mg [Citrus clementina] Length = 436 Score = 65.9 bits (159), Expect = 1e-08 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = -3 Query: 331 LTDELVVVEAKRGCGDSGCYGNLWKNKLRPKLVTQQEATVSGH 203 LTDELVVVEAKR GD+GCYGN+WK KLRPKLV Q + TVSG+ Sbjct: 395 LTDELVVVEAKRKGGDAGCYGNVWKAKLRPKLVAQGD-TVSGN 436