BLASTX nr result
ID: Zanthoxylum22_contig00039475
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00039475 (262 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006481964.1| PREDICTED: auxin response factor 8-like isof... 77 2e-16 ref|XP_006430416.1| hypothetical protein CICLE_v10011065mg [Citr... 77 2e-16 gb|KDO57330.1| hypothetical protein CISIN_1g003544mg [Citrus sin... 77 2e-16 ref|XP_006481965.1| PREDICTED: auxin response factor 8-like isof... 77 2e-16 gb|KDO57331.1| hypothetical protein CISIN_1g003544mg [Citrus sin... 77 2e-16 gb|KDO57329.1| hypothetical protein CISIN_1g003544mg [Citrus sin... 77 2e-16 gb|KDO57328.1| hypothetical protein CISIN_1g003544mg [Citrus sin... 77 2e-16 ref|XP_006430415.1| hypothetical protein CICLE_v10011065mg [Citr... 77 2e-16 gb|KDO57332.1| hypothetical protein CISIN_1g003544mg [Citrus sin... 77 2e-16 ref|XP_006430414.1| hypothetical protein CICLE_v10011065mg [Citr... 77 2e-16 gb|AJA30440.1| auxin response factor 8 [Dimocarpus longan] 77 7e-13 ref|XP_012074114.1| PREDICTED: auxin response factor 8 isoform X... 74 4e-11 ref|XP_002526195.1| Auxin response factor, putative [Ricinus com... 71 4e-10 ref|XP_014504678.1| PREDICTED: auxin response factor 8-like isof... 70 8e-10 ref|XP_014504677.1| PREDICTED: auxin response factor 8-like isof... 70 8e-10 ref|XP_007141982.1| hypothetical protein PHAVU_008G242400g [Phas... 70 8e-10 ref|XP_004490754.1| PREDICTED: auxin response factor 8-like [Cic... 69 1e-09 ref|XP_007032138.1| Auxin response factor 8-1 [Theobroma cacao] ... 69 1e-09 ref|XP_012436682.1| PREDICTED: auxin response factor 8-like isof... 69 2e-09 ref|XP_012436681.1| PREDICTED: auxin response factor 8-like isof... 69 2e-09 >ref|XP_006481964.1| PREDICTED: auxin response factor 8-like isoform X1 [Citrus sinensis] Length = 835 Score = 77.4 bits (189), Expect(2) = 2e-16 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -3 Query: 260 GDDPWEAFVSNVWYIKILSPQDVQTMGEQGVESFNPS 150 GDDPWEAFVSNVWYIKILSP+DVQ MGEQGVESF+PS Sbjct: 778 GDDPWEAFVSNVWYIKILSPEDVQKMGEQGVESFSPS 814 Score = 35.0 bits (79), Expect(2) = 2e-16 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = -2 Query: 144 GHRKNISGNCARDPVGSVEY 85 G R N GNC RDPVGS+EY Sbjct: 816 GQRANSRGNCGRDPVGSLEY 835 >ref|XP_006430416.1| hypothetical protein CICLE_v10011065mg [Citrus clementina] gi|557532473|gb|ESR43656.1| hypothetical protein CICLE_v10011065mg [Citrus clementina] Length = 835 Score = 77.4 bits (189), Expect(2) = 2e-16 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -3 Query: 260 GDDPWEAFVSNVWYIKILSPQDVQTMGEQGVESFNPS 150 GDDPWEAFVSNVWYIKILSP+DVQ MGEQGVESF+PS Sbjct: 778 GDDPWEAFVSNVWYIKILSPEDVQKMGEQGVESFSPS 814 Score = 35.0 bits (79), Expect(2) = 2e-16 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = -2 Query: 144 GHRKNISGNCARDPVGSVEY 85 G R N GNC RDPVGS+EY Sbjct: 816 GQRANSRGNCGRDPVGSLEY 835 >gb|KDO57330.1| hypothetical protein CISIN_1g003544mg [Citrus sinensis] Length = 811 Score = 77.4 bits (189), Expect(2) = 2e-16 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -3 Query: 260 GDDPWEAFVSNVWYIKILSPQDVQTMGEQGVESFNPS 150 GDDPWEAFVSNVWYIKILSP+DVQ MGEQGVESF+PS Sbjct: 754 GDDPWEAFVSNVWYIKILSPEDVQKMGEQGVESFSPS 790 Score = 35.0 bits (79), Expect(2) = 2e-16 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = -2 Query: 144 GHRKNISGNCARDPVGSVEY 85 G R N GNC RDPVGS+EY Sbjct: 792 GQRANSRGNCGRDPVGSLEY 811 >ref|XP_006481965.1| PREDICTED: auxin response factor 8-like isoform X2 [Citrus sinensis] Length = 811 Score = 77.4 bits (189), Expect(2) = 2e-16 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -3 Query: 260 GDDPWEAFVSNVWYIKILSPQDVQTMGEQGVESFNPS 150 GDDPWEAFVSNVWYIKILSP+DVQ MGEQGVESF+PS Sbjct: 754 GDDPWEAFVSNVWYIKILSPEDVQKMGEQGVESFSPS 790 Score = 35.0 bits (79), Expect(2) = 2e-16 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = -2 Query: 144 GHRKNISGNCARDPVGSVEY 85 G R N GNC RDPVGS+EY Sbjct: 792 GQRANSRGNCGRDPVGSLEY 811 >gb|KDO57331.1| hypothetical protein CISIN_1g003544mg [Citrus sinensis] Length = 799 Score = 77.4 bits (189), Expect(2) = 2e-16 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -3 Query: 260 GDDPWEAFVSNVWYIKILSPQDVQTMGEQGVESFNPS 150 GDDPWEAFVSNVWYIKILSP+DVQ MGEQGVESF+PS Sbjct: 742 GDDPWEAFVSNVWYIKILSPEDVQKMGEQGVESFSPS 778 Score = 35.0 bits (79), Expect(2) = 2e-16 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = -2 Query: 144 GHRKNISGNCARDPVGSVEY 85 G R N GNC RDPVGS+EY Sbjct: 780 GQRANSRGNCGRDPVGSLEY 799 >gb|KDO57329.1| hypothetical protein CISIN_1g003544mg [Citrus sinensis] Length = 784 Score = 77.4 bits (189), Expect(2) = 2e-16 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -3 Query: 260 GDDPWEAFVSNVWYIKILSPQDVQTMGEQGVESFNPS 150 GDDPWEAFVSNVWYIKILSP+DVQ MGEQGVESF+PS Sbjct: 727 GDDPWEAFVSNVWYIKILSPEDVQKMGEQGVESFSPS 763 Score = 35.0 bits (79), Expect(2) = 2e-16 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = -2 Query: 144 GHRKNISGNCARDPVGSVEY 85 G R N GNC RDPVGS+EY Sbjct: 765 GQRANSRGNCGRDPVGSLEY 784 >gb|KDO57328.1| hypothetical protein CISIN_1g003544mg [Citrus sinensis] Length = 778 Score = 77.4 bits (189), Expect(2) = 2e-16 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -3 Query: 260 GDDPWEAFVSNVWYIKILSPQDVQTMGEQGVESFNPS 150 GDDPWEAFVSNVWYIKILSP+DVQ MGEQGVESF+PS Sbjct: 721 GDDPWEAFVSNVWYIKILSPEDVQKMGEQGVESFSPS 757 Score = 35.0 bits (79), Expect(2) = 2e-16 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = -2 Query: 144 GHRKNISGNCARDPVGSVEY 85 G R N GNC RDPVGS+EY Sbjct: 759 GQRANSRGNCGRDPVGSLEY 778 >ref|XP_006430415.1| hypothetical protein CICLE_v10011065mg [Citrus clementina] gi|557532472|gb|ESR43655.1| hypothetical protein CICLE_v10011065mg [Citrus clementina] Length = 731 Score = 77.4 bits (189), Expect(2) = 2e-16 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -3 Query: 260 GDDPWEAFVSNVWYIKILSPQDVQTMGEQGVESFNPS 150 GDDPWEAFVSNVWYIKILSP+DVQ MGEQGVESF+PS Sbjct: 674 GDDPWEAFVSNVWYIKILSPEDVQKMGEQGVESFSPS 710 Score = 35.0 bits (79), Expect(2) = 2e-16 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = -2 Query: 144 GHRKNISGNCARDPVGSVEY 85 G R N GNC RDPVGS+EY Sbjct: 712 GQRANSRGNCGRDPVGSLEY 731 >gb|KDO57332.1| hypothetical protein CISIN_1g003544mg [Citrus sinensis] Length = 728 Score = 77.4 bits (189), Expect(2) = 2e-16 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -3 Query: 260 GDDPWEAFVSNVWYIKILSPQDVQTMGEQGVESFNPS 150 GDDPWEAFVSNVWYIKILSP+DVQ MGEQGVESF+PS Sbjct: 671 GDDPWEAFVSNVWYIKILSPEDVQKMGEQGVESFSPS 707 Score = 35.0 bits (79), Expect(2) = 2e-16 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = -2 Query: 144 GHRKNISGNCARDPVGSVEY 85 G R N GNC RDPVGS+EY Sbjct: 709 GQRANSRGNCGRDPVGSLEY 728 >ref|XP_006430414.1| hypothetical protein CICLE_v10011065mg [Citrus clementina] gi|557532471|gb|ESR43654.1| hypothetical protein CICLE_v10011065mg [Citrus clementina] Length = 523 Score = 77.4 bits (189), Expect(2) = 2e-16 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -3 Query: 260 GDDPWEAFVSNVWYIKILSPQDVQTMGEQGVESFNPS 150 GDDPWEAFVSNVWYIKILSP+DVQ MGEQGVESF+PS Sbjct: 466 GDDPWEAFVSNVWYIKILSPEDVQKMGEQGVESFSPS 502 Score = 35.0 bits (79), Expect(2) = 2e-16 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = -2 Query: 144 GHRKNISGNCARDPVGSVEY 85 G R N GNC RDPVGS+EY Sbjct: 504 GQRANSRGNCGRDPVGSLEY 523 >gb|AJA30440.1| auxin response factor 8 [Dimocarpus longan] Length = 831 Score = 77.0 bits (188), Expect(2) = 7e-13 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -3 Query: 260 GDDPWEAFVSNVWYIKILSPQDVQTMGEQGVESFNPS 150 GDDPW+AFV+NVWYIKILSP+DVQ MGEQGVESFNPS Sbjct: 777 GDDPWDAFVNNVWYIKILSPEDVQKMGEQGVESFNPS 813 Score = 23.1 bits (48), Expect(2) = 7e-13 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 126 SGNCARDPVGSVEY 85 S N ARDPV S+EY Sbjct: 818 SRNGARDPVSSLEY 831 >ref|XP_012074114.1| PREDICTED: auxin response factor 8 isoform X1 [Jatropha curcas] gi|643728209|gb|KDP36369.1| hypothetical protein JCGZ_09784 [Jatropha curcas] Length = 830 Score = 73.9 bits (180), Expect = 4e-11 Identities = 31/37 (83%), Positives = 36/37 (97%) Frame = -3 Query: 260 GDDPWEAFVSNVWYIKILSPQDVQTMGEQGVESFNPS 150 GDDPWEAFV+NVWYIKILSP+DVQ +GEQGVESF+P+ Sbjct: 788 GDDPWEAFVNNVWYIKILSPEDVQKLGEQGVESFSPN 824 >ref|XP_002526195.1| Auxin response factor, putative [Ricinus communis] gi|223534499|gb|EEF36199.1| Auxin response factor, putative [Ricinus communis] Length = 826 Score = 70.9 bits (172), Expect = 4e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -3 Query: 260 GDDPWEAFVSNVWYIKILSPQDVQTMGEQGVESFN 156 GDDPWEAFV+NVWYIKILSP+DVQ MGEQGV+SF+ Sbjct: 788 GDDPWEAFVNNVWYIKILSPEDVQKMGEQGVDSFS 822 >ref|XP_014504678.1| PREDICTED: auxin response factor 8-like isoform X2 [Vigna radiata var. radiata] Length = 767 Score = 69.7 bits (169), Expect = 8e-10 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -3 Query: 260 GDDPWEAFVSNVWYIKILSPQDVQTMGEQGVESFNPS 150 GDDPWE+FV+NVWYIKILSP+D+Q MGEQ VES PS Sbjct: 704 GDDPWESFVNNVWYIKILSPEDIQKMGEQAVESLGPS 740 >ref|XP_014504677.1| PREDICTED: auxin response factor 8-like isoform X1 [Vigna radiata var. radiata] Length = 847 Score = 69.7 bits (169), Expect = 8e-10 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -3 Query: 260 GDDPWEAFVSNVWYIKILSPQDVQTMGEQGVESFNPS 150 GDDPWE+FV+NVWYIKILSP+D+Q MGEQ VES PS Sbjct: 784 GDDPWESFVNNVWYIKILSPEDIQKMGEQAVESLGPS 820 >ref|XP_007141982.1| hypothetical protein PHAVU_008G242400g [Phaseolus vulgaris] gi|561015115|gb|ESW13976.1| hypothetical protein PHAVU_008G242400g [Phaseolus vulgaris] Length = 844 Score = 69.7 bits (169), Expect = 8e-10 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -3 Query: 260 GDDPWEAFVSNVWYIKILSPQDVQTMGEQGVESFNPS 150 GDDPWE+FV+NVWYIKILSP+D+Q MGEQ VES PS Sbjct: 781 GDDPWESFVNNVWYIKILSPEDIQKMGEQAVESLGPS 817 >ref|XP_004490754.1| PREDICTED: auxin response factor 8-like [Cicer arietinum] Length = 833 Score = 69.3 bits (168), Expect = 1e-09 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -3 Query: 260 GDDPWEAFVSNVWYIKILSPQDVQTMGEQGVESFNPS 150 GDDPWE+FV+NVWYIKILSP+D+Q MGEQ +ES PS Sbjct: 770 GDDPWESFVNNVWYIKILSPEDIQKMGEQAIESLGPS 806 >ref|XP_007032138.1| Auxin response factor 8-1 [Theobroma cacao] gi|508711167|gb|EOY03064.1| Auxin response factor 8-1 [Theobroma cacao] Length = 838 Score = 68.9 bits (167), Expect = 1e-09 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -3 Query: 260 GDDPWEAFVSNVWYIKILSPQDVQTMGEQGVESFNPS 150 GDDPW+AFV+NVWYIKILSP+DVQ MGEQ VE F+P+ Sbjct: 775 GDDPWDAFVNNVWYIKILSPEDVQKMGEQRVEPFSPT 811 >ref|XP_012436682.1| PREDICTED: auxin response factor 8-like isoform X3 [Gossypium raimondii] Length = 738 Score = 68.6 bits (166), Expect = 2e-09 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -3 Query: 260 GDDPWEAFVSNVWYIKILSPQDVQTMGEQGVESFNPS 150 GDDPWEAFV+NVWYIKILSP+DVQ MGEQ E F+P+ Sbjct: 676 GDDPWEAFVNNVWYIKILSPEDVQKMGEQRAEPFSPT 712 >ref|XP_012436681.1| PREDICTED: auxin response factor 8-like isoform X2 [Gossypium raimondii] Length = 791 Score = 68.6 bits (166), Expect = 2e-09 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -3 Query: 260 GDDPWEAFVSNVWYIKILSPQDVQTMGEQGVESFNPS 150 GDDPWEAFV+NVWYIKILSP+DVQ MGEQ E F+P+ Sbjct: 729 GDDPWEAFVNNVWYIKILSPEDVQKMGEQRAEPFSPT 765