BLASTX nr result
ID: Zanthoxylum22_contig00039417
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00039417 (402 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO75506.1| hypothetical protein CISIN_1g011530mg [Citrus sin... 72 2e-10 gb|KDO75505.1| hypothetical protein CISIN_1g011530mg [Citrus sin... 60 8e-07 ref|XP_006449066.1| hypothetical protein CICLE_v10015055mg [Citr... 57 5e-06 ref|XP_006449065.1| hypothetical protein CICLE_v10015055mg [Citr... 57 5e-06 ref|XP_006449064.1| hypothetical protein CICLE_v10015055mg [Citr... 57 5e-06 ref|XP_006449063.1| hypothetical protein CICLE_v10015055mg [Citr... 57 5e-06 >gb|KDO75506.1| hypothetical protein CISIN_1g011530mg [Citrus sinensis] Length = 354 Score = 72.0 bits (175), Expect = 2e-10 Identities = 35/39 (89%), Positives = 35/39 (89%) Frame = -1 Query: 402 ALAAAPLPVGIMTHYMRPINIAPRLVSEGKNIFSLALMI 286 AL APLPVGIMTHYMRPINIAPRLVSEGK IF LALMI Sbjct: 304 ALTTAPLPVGIMTHYMRPINIAPRLVSEGKTIFGLALMI 342 >gb|KDO75505.1| hypothetical protein CISIN_1g011530mg [Citrus sinensis] Length = 483 Score = 59.7 bits (143), Expect = 8e-07 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = -1 Query: 402 ALAAAPLPVGIMTHYMRPINIAPRLVSEGKNIFSLALM 289 AL APLPVGIMTHYMRPINIAPRLVSEG + L +M Sbjct: 304 ALTTAPLPVGIMTHYMRPINIAPRLVSEGWYLCQLEVM 341 >ref|XP_006449066.1| hypothetical protein CICLE_v10015055mg [Citrus clementina] gi|557551677|gb|ESR62306.1| hypothetical protein CICLE_v10015055mg [Citrus clementina] Length = 487 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -1 Query: 402 ALAAAPLPVGIMTHYMRPINIAPRLVSE 319 AL AAPLPVGIMTHYMRPINIAPRL+SE Sbjct: 304 ALTAAPLPVGIMTHYMRPINIAPRLISE 331 >ref|XP_006449065.1| hypothetical protein CICLE_v10015055mg [Citrus clementina] gi|557551676|gb|ESR62305.1| hypothetical protein CICLE_v10015055mg [Citrus clementina] Length = 334 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -1 Query: 402 ALAAAPLPVGIMTHYMRPINIAPRLVSE 319 AL AAPLPVGIMTHYMRPINIAPRL+SE Sbjct: 151 ALTAAPLPVGIMTHYMRPINIAPRLISE 178 >ref|XP_006449064.1| hypothetical protein CICLE_v10015055mg [Citrus clementina] gi|557551675|gb|ESR62304.1| hypothetical protein CICLE_v10015055mg [Citrus clementina] Length = 469 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -1 Query: 402 ALAAAPLPVGIMTHYMRPINIAPRLVSE 319 AL AAPLPVGIMTHYMRPINIAPRL+SE Sbjct: 286 ALTAAPLPVGIMTHYMRPINIAPRLISE 313 >ref|XP_006449063.1| hypothetical protein CICLE_v10015055mg [Citrus clementina] gi|557551674|gb|ESR62303.1| hypothetical protein CICLE_v10015055mg [Citrus clementina] Length = 392 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -1 Query: 402 ALAAAPLPVGIMTHYMRPINIAPRLVSE 319 AL AAPLPVGIMTHYMRPINIAPRL+SE Sbjct: 209 ALTAAPLPVGIMTHYMRPINIAPRLISE 236