BLASTX nr result
ID: Zanthoxylum22_contig00039390
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00039390 (260 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008810046.1| PREDICTED: lisH domain and HEAT repeat-conta... 63 7e-08 ref|XP_008810045.1| PREDICTED: lisH domain and HEAT repeat-conta... 63 7e-08 gb|KDO63204.1| hypothetical protein CISIN_1g001018mg [Citrus sin... 61 3e-07 ref|XP_002528079.1| conserved hypothetical protein [Ricinus comm... 61 3e-07 ref|XP_006482204.1| PREDICTED: lisH domain and HEAT repeat-conta... 61 3e-07 ref|XP_006482203.1| PREDICTED: lisH domain and HEAT repeat-conta... 61 3e-07 ref|XP_006430723.1| hypothetical protein CICLE_v10010937mg [Citr... 61 3e-07 ref|XP_009395565.1| PREDICTED: lisH domain and HEAT repeat-conta... 60 6e-07 ref|XP_010108887.1| LisH domain and HEAT repeat-containing prote... 59 1e-06 gb|KJB10468.1| hypothetical protein B456_001G202700 [Gossypium r... 59 1e-06 gb|KJB10467.1| hypothetical protein B456_001G202700 [Gossypium r... 59 1e-06 gb|KJB10466.1| hypothetical protein B456_001G202700 [Gossypium r... 59 1e-06 gb|KJB10465.1| hypothetical protein B456_001G202700 [Gossypium r... 59 1e-06 ref|XP_012487871.1| PREDICTED: lisH domain and HEAT repeat-conta... 59 1e-06 ref|XP_012487872.1| PREDICTED: lisH domain and HEAT repeat-conta... 59 1e-06 gb|KHN47235.1| LisH domain and HEAT repeat-containing protein KI... 59 1e-06 ref|XP_010693468.1| PREDICTED: lisH domain and HEAT repeat-conta... 59 1e-06 gb|KHG01142.1| LisH domain and HEAT repeat-containing protein [G... 59 1e-06 ref|XP_010062208.1| PREDICTED: lisH domain and HEAT repeat-conta... 59 1e-06 ref|XP_009344129.1| PREDICTED: lisH domain and HEAT repeat-conta... 59 1e-06 >ref|XP_008810046.1| PREDICTED: lisH domain and HEAT repeat-containing protein KIAA1468 homolog isoform X2 [Phoenix dactylifera] Length = 1192 Score = 63.2 bits (152), Expect = 7e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 99 SEREMDVERSSLCNCVVNFLLEEKYLLTAFELL 1 S R MDVERSSLCNCVVNFLL+EKYLLTAFELL Sbjct: 5 SSRAMDVERSSLCNCVVNFLLQEKYLLTAFELL 37 >ref|XP_008810045.1| PREDICTED: lisH domain and HEAT repeat-containing protein KIAA1468 homolog isoform X1 [Phoenix dactylifera] Length = 1217 Score = 63.2 bits (152), Expect = 7e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 99 SEREMDVERSSLCNCVVNFLLEEKYLLTAFELL 1 S R MDVERSSLCNCVVNFLL+EKYLLTAFELL Sbjct: 5 SSRAMDVERSSLCNCVVNFLLQEKYLLTAFELL 37 >gb|KDO63204.1| hypothetical protein CISIN_1g001018mg [Citrus sinensis] Length = 1188 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 87 MDVERSSLCNCVVNFLLEEKYLLTAFELL 1 MDVERSSLCNCVVNFLLEEKYLLTAFELL Sbjct: 1 MDVERSSLCNCVVNFLLEEKYLLTAFELL 29 >ref|XP_002528079.1| conserved hypothetical protein [Ricinus communis] gi|223532540|gb|EEF34329.1| conserved hypothetical protein [Ricinus communis] Length = 1167 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 87 MDVERSSLCNCVVNFLLEEKYLLTAFELL 1 MDVERSSLCNCVVNFLLEEKYLLTAFELL Sbjct: 1 MDVERSSLCNCVVNFLLEEKYLLTAFELL 29 >ref|XP_006482204.1| PREDICTED: lisH domain and HEAT repeat-containing protein KIAA1468 homolog isoform X2 [Citrus sinensis] Length = 1188 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 87 MDVERSSLCNCVVNFLLEEKYLLTAFELL 1 MDVERSSLCNCVVNFLLEEKYLLTAFELL Sbjct: 1 MDVERSSLCNCVVNFLLEEKYLLTAFELL 29 >ref|XP_006482203.1| PREDICTED: lisH domain and HEAT repeat-containing protein KIAA1468 homolog isoform X1 [Citrus sinensis] Length = 1213 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 87 MDVERSSLCNCVVNFLLEEKYLLTAFELL 1 MDVERSSLCNCVVNFLLEEKYLLTAFELL Sbjct: 1 MDVERSSLCNCVVNFLLEEKYLLTAFELL 29 >ref|XP_006430723.1| hypothetical protein CICLE_v10010937mg [Citrus clementina] gi|557532780|gb|ESR43963.1| hypothetical protein CICLE_v10010937mg [Citrus clementina] Length = 1188 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 87 MDVERSSLCNCVVNFLLEEKYLLTAFELL 1 MDVERSSLCNCVVNFLLEEKYLLTAFELL Sbjct: 1 MDVERSSLCNCVVNFLLEEKYLLTAFELL 29 >ref|XP_009395565.1| PREDICTED: lisH domain and HEAT repeat-containing protein KIAA1468 homolog [Musa acuminata subsp. malaccensis] Length = 1199 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -3 Query: 99 SEREMDVERSSLCNCVVNFLLEEKYLLTAFELL 1 S R MDVER+SLCNCVVNFLL+E YLLTAFELL Sbjct: 10 SRRAMDVERTSLCNCVVNFLLQENYLLTAFELL 42 >ref|XP_010108887.1| LisH domain and HEAT repeat-containing protein KIAA1468-like protein [Morus notabilis] gi|587933564|gb|EXC20527.1| LisH domain and HEAT repeat-containing protein KIAA1468-like protein [Morus notabilis] Length = 213 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 87 MDVERSSLCNCVVNFLLEEKYLLTAFELL 1 MDVERSSLCNCVVNFLLEE YLLTAFELL Sbjct: 1 MDVERSSLCNCVVNFLLEENYLLTAFELL 29 >gb|KJB10468.1| hypothetical protein B456_001G202700 [Gossypium raimondii] Length = 1085 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 87 MDVERSSLCNCVVNFLLEEKYLLTAFELL 1 MDVERSSLCNCVVNFLLEE YLLTAFELL Sbjct: 2 MDVERSSLCNCVVNFLLEENYLLTAFELL 30 >gb|KJB10467.1| hypothetical protein B456_001G202700 [Gossypium raimondii] Length = 1144 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 87 MDVERSSLCNCVVNFLLEEKYLLTAFELL 1 MDVERSSLCNCVVNFLLEE YLLTAFELL Sbjct: 2 MDVERSSLCNCVVNFLLEENYLLTAFELL 30 >gb|KJB10466.1| hypothetical protein B456_001G202700 [Gossypium raimondii] Length = 1185 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 87 MDVERSSLCNCVVNFLLEEKYLLTAFELL 1 MDVERSSLCNCVVNFLLEE YLLTAFELL Sbjct: 2 MDVERSSLCNCVVNFLLEENYLLTAFELL 30 >gb|KJB10465.1| hypothetical protein B456_001G202700 [Gossypium raimondii] Length = 1067 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 87 MDVERSSLCNCVVNFLLEEKYLLTAFELL 1 MDVERSSLCNCVVNFLLEE YLLTAFELL Sbjct: 2 MDVERSSLCNCVVNFLLEENYLLTAFELL 30 >ref|XP_012487871.1| PREDICTED: lisH domain and HEAT repeat-containing protein KIAA1468-like isoform X1 [Gossypium raimondii] gi|763742965|gb|KJB10464.1| hypothetical protein B456_001G202700 [Gossypium raimondii] Length = 1185 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 87 MDVERSSLCNCVVNFLLEEKYLLTAFELL 1 MDVERSSLCNCVVNFLLEE YLLTAFELL Sbjct: 2 MDVERSSLCNCVVNFLLEENYLLTAFELL 30 >ref|XP_012487872.1| PREDICTED: lisH domain and HEAT repeat-containing protein KIAA1468-like isoform X2 [Gossypium raimondii] gi|763742964|gb|KJB10463.1| hypothetical protein B456_001G202700 [Gossypium raimondii] Length = 1184 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 87 MDVERSSLCNCVVNFLLEEKYLLTAFELL 1 MDVERSSLCNCVVNFLLEE YLLTAFELL Sbjct: 2 MDVERSSLCNCVVNFLLEENYLLTAFELL 30 >gb|KHN47235.1| LisH domain and HEAT repeat-containing protein KIAA1468-like protein [Glycine soja] Length = 1157 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 87 MDVERSSLCNCVVNFLLEEKYLLTAFELL 1 MDVERSSLCNCVVNFLLEE YLLTAFELL Sbjct: 1 MDVERSSLCNCVVNFLLEENYLLTAFELL 29 >ref|XP_010693468.1| PREDICTED: lisH domain and HEAT repeat-containing protein KIAA1468 homolog [Beta vulgaris subsp. vulgaris] gi|870867727|gb|KMT18596.1| hypothetical protein BVRB_2g027270 [Beta vulgaris subsp. vulgaris] Length = 1183 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 87 MDVERSSLCNCVVNFLLEEKYLLTAFELL 1 MDVERSSLCNCVVNFLLEE YLLTAFELL Sbjct: 2 MDVERSSLCNCVVNFLLEENYLLTAFELL 30 >gb|KHG01142.1| LisH domain and HEAT repeat-containing protein [Gossypium arboreum] Length = 1168 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 87 MDVERSSLCNCVVNFLLEEKYLLTAFELL 1 MDVERSSLCNCVVNFLLEE YLLTAFELL Sbjct: 2 MDVERSSLCNCVVNFLLEENYLLTAFELL 30 >ref|XP_010062208.1| PREDICTED: lisH domain and HEAT repeat-containing protein KIAA1468 homolog isoform X2 [Eucalyptus grandis] Length = 1179 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 87 MDVERSSLCNCVVNFLLEEKYLLTAFELL 1 MDVERSSLCNCVVNFLLEE YLLTAFELL Sbjct: 1 MDVERSSLCNCVVNFLLEENYLLTAFELL 29 >ref|XP_009344129.1| PREDICTED: lisH domain and HEAT repeat-containing protein KIAA1468 homolog isoform X1 [Pyrus x bretschneideri] Length = 1178 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 87 MDVERSSLCNCVVNFLLEEKYLLTAFELL 1 MDVERSSLCNCVVNFLLEE YLLTAFELL Sbjct: 1 MDVERSSLCNCVVNFLLEENYLLTAFELL 29