BLASTX nr result
ID: Zanthoxylum22_contig00039251
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00039251 (352 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006472057.1| PREDICTED: uncharacterized protein LOC102629... 54 5e-11 >ref|XP_006472057.1| PREDICTED: uncharacterized protein LOC102629262 [Citrus sinensis] gi|641837320|gb|KDO56275.1| hypothetical protein CISIN_1g033678mg [Citrus sinensis] Length = 114 Score = 54.3 bits (129), Expect(2) = 5e-11 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = -2 Query: 114 QKMLWERTPLGALSNKSITISGTNDLAPCISNRGLFSV 1 +KM W + PLGAL+ +I++SGTN L PC SNRGLFSV Sbjct: 21 KKMCWGKEPLGALAKTAISVSGTNHLFPCSSNRGLFSV 58 Score = 39.7 bits (91), Expect(2) = 5e-11 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 287 VAYLVSISFSTALCAPPTSLK 225 +AYLVSISFST LCAPPTS K Sbjct: 1 MAYLVSISFSTPLCAPPTSFK 21