BLASTX nr result
ID: Zanthoxylum22_contig00039246
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00039246 (360 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHG23098.1| CBS domain-containing CBSX5 -like protein [Gossyp... 64 6e-08 ref|XP_007021351.1| Cystathionine beta-synthase family protein i... 63 8e-08 ref|XP_007021350.1| Cystathionine beta-synthase family protein i... 63 8e-08 ref|XP_008226660.1| PREDICTED: CBS domain-containing protein CBS... 62 1e-07 ref|XP_007149600.1| hypothetical protein PHAVU_005G083300g [Phas... 62 1e-07 ref|XP_007214676.1| hypothetical protein PRUPE_ppa022868mg [Prun... 62 1e-07 ref|XP_012458524.1| PREDICTED: CBS domain-containing protein CBS... 62 2e-07 gb|KDO74118.1| hypothetical protein CISIN_1g016003mg [Citrus sin... 61 3e-07 ref|XP_006451922.1| hypothetical protein CICLE_v10008537mg [Citr... 61 3e-07 ref|XP_004291656.1| PREDICTED: CBS domain-containing protein CBS... 61 4e-07 ref|XP_014502646.1| PREDICTED: CBS domain-containing protein CBS... 60 5e-07 gb|KOM43638.1| hypothetical protein LR48_Vigan05g124300 [Vigna a... 60 5e-07 gb|KHN28045.1| CBS domain-containing protein CBSX5 [Glycine soja] 60 5e-07 ref|XP_003540455.1| PREDICTED: CBS domain-containing protein CBS... 60 5e-07 ref|XP_009378480.1| PREDICTED: CBS domain-containing protein CBS... 59 1e-06 ref|XP_008452474.1| PREDICTED: CBS domain-containing protein CBS... 59 1e-06 ref|XP_004141365.1| PREDICTED: CBS domain-containing protein CBS... 59 1e-06 gb|KHN36802.1| CBS domain-containing protein CBSX5 [Glycine soja] 59 1e-06 ref|XP_002284800.1| PREDICTED: CBS domain-containing protein CBS... 59 1e-06 ref|XP_002528574.1| conserved hypothetical protein [Ricinus comm... 59 1e-06 >gb|KHG23098.1| CBS domain-containing CBSX5 -like protein [Gossypium arboreum] Length = 403 Score = 63.5 bits (153), Expect = 6e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -2 Query: 359 NYVWVIEDDCSLTGIVTFTDMLKVFRDHLVTMA 261 NYVWVIEDDCSL GIVTF+DMLKVFR+HL T+A Sbjct: 371 NYVWVIEDDCSLVGIVTFSDMLKVFREHLETIA 403 >ref|XP_007021351.1| Cystathionine beta-synthase family protein isoform 2, partial [Theobroma cacao] gi|508720979|gb|EOY12876.1| Cystathionine beta-synthase family protein isoform 2, partial [Theobroma cacao] Length = 291 Score = 63.2 bits (152), Expect = 8e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -2 Query: 359 NYVWVIEDDCSLTGIVTFTDMLKVFRDHLVTMA 261 NYVWVIEDDCSL GIVTF+D+LKVFR+HL TMA Sbjct: 259 NYVWVIEDDCSLVGIVTFSDILKVFREHLDTMA 291 >ref|XP_007021350.1| Cystathionine beta-synthase family protein isoform 1 [Theobroma cacao] gi|508720978|gb|EOY12875.1| Cystathionine beta-synthase family protein isoform 1 [Theobroma cacao] Length = 406 Score = 63.2 bits (152), Expect = 8e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -2 Query: 359 NYVWVIEDDCSLTGIVTFTDMLKVFRDHLVTMA 261 NYVWVIEDDCSL GIVTF+D+LKVFR+HL TMA Sbjct: 374 NYVWVIEDDCSLVGIVTFSDILKVFREHLDTMA 406 >ref|XP_008226660.1| PREDICTED: CBS domain-containing protein CBSX5 [Prunus mume] Length = 400 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -2 Query: 359 NYVWVIEDDCSLTGIVTFTDMLKVFRDHLVTMA 261 NYVWVIEDDCSL GIVTF+ MLKVFR+HL TMA Sbjct: 368 NYVWVIEDDCSLVGIVTFSGMLKVFREHLETMA 400 >ref|XP_007149600.1| hypothetical protein PHAVU_005G083300g [Phaseolus vulgaris] gi|561022864|gb|ESW21594.1| hypothetical protein PHAVU_005G083300g [Phaseolus vulgaris] Length = 393 Score = 62.4 bits (150), Expect = 1e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 359 NYVWVIEDDCSLTGIVTFTDMLKVFRDHLVTM 264 NY+WVIEDDCSL GIVTF+DMLKVFR+HL TM Sbjct: 362 NYLWVIEDDCSLVGIVTFSDMLKVFREHLETM 393 >ref|XP_007214676.1| hypothetical protein PRUPE_ppa022868mg [Prunus persica] gi|462410541|gb|EMJ15875.1| hypothetical protein PRUPE_ppa022868mg [Prunus persica] Length = 400 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -2 Query: 359 NYVWVIEDDCSLTGIVTFTDMLKVFRDHLVTMA 261 NYVWVIEDDCSL GIVTF+ MLKVFR+HL TMA Sbjct: 368 NYVWVIEDDCSLVGIVTFSGMLKVFREHLETMA 400 >ref|XP_012458524.1| PREDICTED: CBS domain-containing protein CBSX5-like [Gossypium raimondii] gi|763745963|gb|KJB13402.1| hypothetical protein B456_002G072600 [Gossypium raimondii] Length = 403 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 359 NYVWVIEDDCSLTGIVTFTDMLKVFRDHLVTMA 261 NYVWVIEDDC L GIVTF+DMLKVFR+HL T+A Sbjct: 371 NYVWVIEDDCRLVGIVTFSDMLKVFREHLETIA 403 >gb|KDO74118.1| hypothetical protein CISIN_1g016003mg [Citrus sinensis] Length = 397 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 356 YVWVIEDDCSLTGIVTFTDMLKVFRDHLVTMA 261 YVWVIEDDC+LTGIVTF+D+LKVFR HL TMA Sbjct: 366 YVWVIEDDCTLTGIVTFSDLLKVFRKHLETMA 397 >ref|XP_006451922.1| hypothetical protein CICLE_v10008537mg [Citrus clementina] gi|568820423|ref|XP_006464720.1| PREDICTED: CBS domain-containing protein CBSX5-like [Citrus sinensis] gi|557555148|gb|ESR65162.1| hypothetical protein CICLE_v10008537mg [Citrus clementina] Length = 397 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 356 YVWVIEDDCSLTGIVTFTDMLKVFRDHLVTMA 261 YVWVIEDDC+LTGIVTF+D+LKVFR HL TMA Sbjct: 366 YVWVIEDDCTLTGIVTFSDLLKVFRKHLETMA 397 >ref|XP_004291656.1| PREDICTED: CBS domain-containing protein CBSX5-like [Fragaria vesca subsp. vesca] Length = 403 Score = 60.8 bits (146), Expect = 4e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -2 Query: 359 NYVWVIEDDCSLTGIVTFTDMLKVFRDHLVTM 264 NYVWVIEDDCSL GIVTF+ MLKVFR+HL TM Sbjct: 371 NYVWVIEDDCSLVGIVTFSGMLKVFREHLETM 402 >ref|XP_014502646.1| PREDICTED: CBS domain-containing protein CBSX5 [Vigna radiata var. radiata] Length = 392 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -2 Query: 359 NYVWVIEDDCSLTGIVTFTDMLKVFRDHLVTM 264 NY+WVIEDDCSL GIVTF++MLKVFR+HL TM Sbjct: 361 NYLWVIEDDCSLVGIVTFSNMLKVFREHLETM 392 >gb|KOM43638.1| hypothetical protein LR48_Vigan05g124300 [Vigna angularis] Length = 392 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -2 Query: 359 NYVWVIEDDCSLTGIVTFTDMLKVFRDHLVTM 264 NY+WVIEDDCSL GIVTF++MLKVFR+HL TM Sbjct: 361 NYLWVIEDDCSLVGIVTFSNMLKVFREHLETM 392 >gb|KHN28045.1| CBS domain-containing protein CBSX5 [Glycine soja] Length = 390 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -2 Query: 359 NYVWVIEDDCSLTGIVTFTDMLKVFRDHLVTM 264 NY+WVIEDDCSL GIVTF++MLKVFR+HL TM Sbjct: 359 NYLWVIEDDCSLVGIVTFSNMLKVFREHLETM 390 >ref|XP_003540455.1| PREDICTED: CBS domain-containing protein CBSX5-like [Glycine max] gi|947078375|gb|KRH27215.1| hypothetical protein GLYMA_12G222500 [Glycine max] Length = 390 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -2 Query: 359 NYVWVIEDDCSLTGIVTFTDMLKVFRDHLVTM 264 NY+WVIEDDCSL GIVTF++MLKVFR+HL TM Sbjct: 359 NYLWVIEDDCSLVGIVTFSNMLKVFREHLETM 390 >ref|XP_009378480.1| PREDICTED: CBS domain-containing protein CBSX5 [Pyrus x bretschneideri] Length = 411 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 359 NYVWVIEDDCSLTGIVTFTDMLKVFRDHLVTM 264 NYVWVIEDDCSL GIVTF+ ML+VFR+HL TM Sbjct: 379 NYVWVIEDDCSLVGIVTFSGMLEVFREHLETM 410 >ref|XP_008452474.1| PREDICTED: CBS domain-containing protein CBSX5 [Cucumis melo] Length = 401 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -2 Query: 359 NYVWVIEDDCSLTGIVTFTDMLKVFRDHLVT 267 NYVWVIEDDCSL G+VTF DMLKVFR+HL T Sbjct: 369 NYVWVIEDDCSLIGMVTFLDMLKVFREHLET 399 >ref|XP_004141365.1| PREDICTED: CBS domain-containing protein CBSX5 [Cucumis sativus] gi|700199984|gb|KGN55142.1| hypothetical protein Csa_4G637820 [Cucumis sativus] Length = 401 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -2 Query: 359 NYVWVIEDDCSLTGIVTFTDMLKVFRDHLVT 267 NYVWVIEDDCSL G+VTF DMLKVFR+HL T Sbjct: 369 NYVWVIEDDCSLIGMVTFLDMLKVFREHLET 399 >gb|KHN36802.1| CBS domain-containing protein CBSX5 [Glycine soja] Length = 324 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -2 Query: 359 NYVWVIEDDCSLTGIVTFTDMLKVFRDHLVTM 264 NY+WVIEDDCSL GIVTF++MLKVFR+HL T+ Sbjct: 293 NYLWVIEDDCSLVGIVTFSNMLKVFREHLETI 324 >ref|XP_002284800.1| PREDICTED: CBS domain-containing protein CBSX5 [Vitis vinifera] gi|302143038|emb|CBI20333.3| unnamed protein product [Vitis vinifera] Length = 394 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -2 Query: 359 NYVWVIEDDCSLTGIVTFTDMLKVFRDHLVTMA 261 NYVWVIEDDC L GIVTF+ MLK+FR+HL +MA Sbjct: 362 NYVWVIEDDCCLAGIVTFSSMLKIFREHLQSMA 394 >ref|XP_002528574.1| conserved hypothetical protein [Ricinus communis] gi|223532018|gb|EEF33829.1| conserved hypothetical protein [Ricinus communis] Length = 408 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -2 Query: 359 NYVWVIEDDCSLTGIVTFTDMLKVFRDHLVTMA 261 NYVWVIE+DCSL GIVTF +MLKVFR+HL MA Sbjct: 376 NYVWVIEEDCSLVGIVTFCNMLKVFREHLEAMA 408