BLASTX nr result
ID: Zanthoxylum22_contig00039160
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00039160 (499 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB09734.1| hypothetical protein B456_001G161000, partial [Go... 95 4e-20 ref|YP_173477.1| hypothetical protein NitaMp140 [Nicotiana tabac... 84 5e-14 ref|NP_064104.1| orf110b gene product (mitochondrion) [Beta vulg... 80 8e-13 >gb|KJB09734.1| hypothetical protein B456_001G161000, partial [Gossypium raimondii] Length = 244 Score = 79.7 bits (195), Expect(2) = 4e-20 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +3 Query: 3 GFEPLTQGFSVLCSNQLSYLNHFPKVCFLHRIAPYLTS 116 GFEPLTQGFSVLCSNQLSYLNHFPKV FLHRIAPYLT+ Sbjct: 105 GFEPLTQGFSVLCSNQLSYLNHFPKVSFLHRIAPYLTT 142 Score = 45.1 bits (105), Expect(2) = 4e-20 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = +1 Query: 163 IFSLVRQAFEQLF*LPPNLPTC 228 +FSLVRQAFEQLF LPPNLPTC Sbjct: 156 LFSLVRQAFEQLFQLPPNLPTC 177 Score = 94.7 bits (234), Expect = 2e-17 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = +2 Query: 359 VVLFCPPGDSTKRFFLSRNFARPFNFRAGGNGIRTHDTIFLYVDLAN 499 +VLFCPPGDSTKRFFLSRNFA P +FRAGGNGIRTHDTIFLYVDLAN Sbjct: 182 IVLFCPPGDSTKRFFLSRNFACPLDFRAGGNGIRTHDTIFLYVDLAN 228 >ref|YP_173477.1| hypothetical protein NitaMp140 [Nicotiana tabacum] gi|56806642|dbj|BAD83543.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 116 Score = 83.6 bits (205), Expect = 5e-14 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +3 Query: 3 GFEPLTQGFSVLCSNQLSYLNHFPKVCFLHRIAPYLTS 116 GFEPLTQGFSVLCSNQLSYLNHFPKVCFLHRIAPYLT+ Sbjct: 79 GFEPLTQGFSVLCSNQLSYLNHFPKVCFLHRIAPYLTT 116 >ref|NP_064104.1| orf110b gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435128|ref|YP_004222346.1| hypothetical protein BevumaM_p112 [Beta vulgaris subsp. maritima] gi|346683219|ref|YP_004842151.1| hypothetical protein BemaM_p107 [Beta macrocarpa] gi|9087354|dbj|BAA99498.1| orf110b (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|317905682|emb|CBJ14076.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439861|emb|CBJ17566.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320148051|emb|CBJ20714.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500137|emb|CBX24956.1| hypothetical protein [Beta macrocarpa] gi|384939116|emb|CBL51962.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 110 Score = 79.7 bits (195), Expect = 8e-13 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +3 Query: 3 GFEPLTQGFSVLCSNQLSYLNHFPKVCFLHRIAPY 107 GFEPLTQGFSVLCSNQLSYLNHFPKVCFLHRIAPY Sbjct: 49 GFEPLTQGFSVLCSNQLSYLNHFPKVCFLHRIAPY 83