BLASTX nr result
ID: Zanthoxylum22_contig00039132
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00039132 (468 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010088771.1| hypothetical protein L484_018330 [Morus nota... 88 3e-15 >ref|XP_010088771.1| hypothetical protein L484_018330 [Morus notabilis] gi|587846476|gb|EXB36954.1| hypothetical protein L484_018330 [Morus notabilis] Length = 217 Score = 87.8 bits (216), Expect = 3e-15 Identities = 39/43 (90%), Positives = 39/43 (90%) Frame = +3 Query: 12 P*AHCWKGSASKPYVELPPHTAPLGMEVGPAQACAVKVFVHDL 140 P HCWKGSASKPYVELPPHTAPLGMEVGP QACAVKV VHDL Sbjct: 54 PRPHCWKGSASKPYVELPPHTAPLGMEVGPTQACAVKVVVHDL 96