BLASTX nr result
ID: Zanthoxylum22_contig00038990
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00038990 (719 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002536332.1| conserved hypothetical protein [Ricinus comm... 100 1e-18 >ref|XP_002536332.1| conserved hypothetical protein [Ricinus communis] gi|255612608|ref|XP_002539428.1| conserved hypothetical protein [Ricinus communis] gi|223506246|gb|EEF22955.1| conserved hypothetical protein [Ricinus communis] gi|223520066|gb|EEF26051.1| conserved hypothetical protein [Ricinus communis] Length = 107 Score = 100 bits (248), Expect = 1e-18 Identities = 52/62 (83%), Positives = 55/62 (88%) Frame = +2 Query: 23 SHKQAVRSTAPASHIYSSIILIEGTSEIGRTGPRPGREQHRSGNSPTRRSKAISDMGKTK 202 ++ + VRSTAPASHIYSSIILIEG SEIGRTG PGREQHRSGNSPTRRSKAISDM K K Sbjct: 48 AYSEGVRSTAPASHIYSSIILIEGPSEIGRTG--PGREQHRSGNSPTRRSKAISDMEKMK 105 Query: 203 LT 208 LT Sbjct: 106 LT 107