BLASTX nr result
ID: Zanthoxylum22_contig00038985
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00038985 (256 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAA84682.1| unknown protein (chloroplast) [Nicotiana tabacum]... 57 4e-06 >gb|AAA84682.1| unknown protein (chloroplast) [Nicotiana tabacum] gi|224352|prf||1102209F ORF 6 Length = 79 Score = 57.4 bits (137), Expect = 4e-06 Identities = 34/65 (52%), Positives = 42/65 (64%), Gaps = 1/65 (1%) Frame = +1 Query: 22 MKVDYLSIHLKTSMIPSRTKHEIFDSFGSHTQLRQLLMYGGGFPYLFLM**AYPL-SSLF 198 MKVDY SI + S+IPSRTKHE FDSFGSH QL ++ ++F P+ SSLF Sbjct: 1 MKVDYFSIPFQNSIIPSRTKHESFDSFGSHAQLLKV------NSHIFFYECNEPIFSSLF 54 Query: 199 IFQNE 213 IFQ + Sbjct: 55 IFQKD 59