BLASTX nr result
ID: Zanthoxylum22_contig00038874
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00038874 (465 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006484317.1| PREDICTED: proline-rich receptor-like protei... 100 6e-19 gb|KDO82408.1| hypothetical protein CISIN_1g046750mg [Citrus sin... 63 8e-08 ref|XP_006438377.1| hypothetical protein CICLE_v10033635mg [Citr... 63 8e-08 >ref|XP_006484317.1| PREDICTED: proline-rich receptor-like protein kinase PERK13-like [Citrus sinensis] Length = 743 Score = 100 bits (248), Expect = 6e-19 Identities = 45/52 (86%), Positives = 47/52 (90%) Frame = -1 Query: 156 HYMPPPNNFNEKAAHLDAYYCSQNYQMGNSGPVDTYYGSQTPQMHSYGSRRG 1 HYMPPPNNFNEK DAYY +QNYQMGNSGPVDTYYGSQTPQMHSYGS+RG Sbjct: 298 HYMPPPNNFNEKT---DAYYYTQNYQMGNSGPVDTYYGSQTPQMHSYGSQRG 346 >gb|KDO82408.1| hypothetical protein CISIN_1g046750mg [Citrus sinensis] Length = 723 Score = 63.2 bits (152), Expect = 8e-08 Identities = 31/52 (59%), Positives = 32/52 (61%) Frame = -1 Query: 156 HYMPPPNNFNEKAAHLDAYYCSQNYQMGNSGPVDTYYGSQTPQMHSYGSRRG 1 HYMPPPNNFNEK VDTYYGSQTPQMHSYGS+RG Sbjct: 298 HYMPPPNNFNEKT-------------------VDTYYGSQTPQMHSYGSQRG 330 >ref|XP_006438377.1| hypothetical protein CICLE_v10033635mg [Citrus clementina] gi|557540573|gb|ESR51617.1| hypothetical protein CICLE_v10033635mg [Citrus clementina] Length = 737 Score = 63.2 bits (152), Expect = 8e-08 Identities = 31/52 (59%), Positives = 32/52 (61%) Frame = -1 Query: 156 HYMPPPNNFNEKAAHLDAYYCSQNYQMGNSGPVDTYYGSQTPQMHSYGSRRG 1 HYMPPPNNFNEK VDTYYGSQTPQMHSYGS+RG Sbjct: 298 HYMPPPNNFNEKT-------------------VDTYYGSQTPQMHSYGSQRG 330