BLASTX nr result
ID: Zanthoxylum22_contig00038805
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00038805 (319 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006466415.1| PREDICTED: pentatricopeptide repeat-containi... 179 9e-43 ref|XP_006426150.1| hypothetical protein CICLE_v10025015mg [Citr... 179 9e-43 gb|KDO78834.1| hypothetical protein CISIN_1g037537mg, partial [C... 167 2e-39 ref|XP_010999919.1| PREDICTED: pentatricopeptide repeat-containi... 162 1e-37 ref|XP_002320672.2| pentatricopeptide repeat-containing family p... 162 1e-37 ref|XP_007047622.1| Pentatricopeptide repeat (PPR) superfamily p... 160 3e-37 ref|XP_002530602.1| pentatricopeptide repeat-containing protein,... 152 7e-35 ref|XP_012437174.1| PREDICTED: pentatricopeptide repeat-containi... 150 3e-34 ref|XP_008442084.1| PREDICTED: pentatricopeptide repeat-containi... 149 1e-33 ref|XP_012079465.1| PREDICTED: pentatricopeptide repeat-containi... 148 1e-33 ref|XP_008342220.1| PREDICTED: pentatricopeptide repeat-containi... 147 2e-33 emb|CBI29560.3| unnamed protein product [Vitis vinifera] 147 4e-33 ref|XP_002268807.2| PREDICTED: pentatricopeptide repeat-containi... 147 4e-33 emb|CAN74731.1| hypothetical protein VITISV_037837 [Vitis vinifera] 147 4e-33 ref|XP_010647376.1| PREDICTED: pentatricopeptide repeat-containi... 145 1e-32 emb|CDP02643.1| unnamed protein product [Coffea canephora] 145 1e-32 emb|CBI18837.3| unnamed protein product [Vitis vinifera] 145 1e-32 ref|XP_010099413.1| hypothetical protein L484_007776 [Morus nota... 145 1e-32 ref|XP_004146400.1| PREDICTED: pentatricopeptide repeat-containi... 145 1e-32 ref|XP_010041244.1| PREDICTED: pentatricopeptide repeat-containi... 144 2e-32 >ref|XP_006466415.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49710-like [Citrus sinensis] Length = 718 Score = 179 bits (453), Expect = 9e-43 Identities = 83/105 (79%), Positives = 95/105 (90%) Frame = -2 Query: 315 SWTLQTFRQLLKTCIAQRNLLTGKSLHALYLKNLIPYSTYLSNHFILLYSKCGCLAAAHH 136 SWTLQTFRQ+LKTC+ +R+L+TGKSLHALYLKNL+P+S YLSNHFILLYSKCGCL+AAHH Sbjct: 5 SWTLQTFRQVLKTCVGRRDLVTGKSLHALYLKNLVPFSAYLSNHFILLYSKCGCLSAAHH 64 Query: 135 AFNHTHDANVFSFNVLLAAHVKHSCVATARQLFDLIPQPDLVSYN 1 AFN T ANVFSFNVLLAA+ + +A+ARQLFD IPQPDLVSYN Sbjct: 65 AFNQTQHANVFSFNVLLAAYARQLRIASARQLFDQIPQPDLVSYN 109 >ref|XP_006426150.1| hypothetical protein CICLE_v10025015mg [Citrus clementina] gi|557528140|gb|ESR39390.1| hypothetical protein CICLE_v10025015mg [Citrus clementina] Length = 718 Score = 179 bits (453), Expect = 9e-43 Identities = 83/105 (79%), Positives = 95/105 (90%) Frame = -2 Query: 315 SWTLQTFRQLLKTCIAQRNLLTGKSLHALYLKNLIPYSTYLSNHFILLYSKCGCLAAAHH 136 SWTLQTFRQ+LKTC+ +R+L+TGKSLHALYLKNL+P+S YLSNHFILLYSKCGCL+AAHH Sbjct: 5 SWTLQTFRQVLKTCVGRRDLVTGKSLHALYLKNLVPFSAYLSNHFILLYSKCGCLSAAHH 64 Query: 135 AFNHTHDANVFSFNVLLAAHVKHSCVATARQLFDLIPQPDLVSYN 1 AFN T ANVFSFNVLLAA+ + +A+ARQLFD IPQPDLVSYN Sbjct: 65 AFNQTQHANVFSFNVLLAAYARQLRIASARQLFDQIPQPDLVSYN 109 >gb|KDO78834.1| hypothetical protein CISIN_1g037537mg, partial [Citrus sinensis] Length = 677 Score = 167 bits (424), Expect = 2e-39 Identities = 78/100 (78%), Positives = 90/100 (90%) Frame = -2 Query: 300 TFRQLLKTCIAQRNLLTGKSLHALYLKNLIPYSTYLSNHFILLYSKCGCLAAAHHAFNHT 121 TFRQ+LKTC+ +R+L+TGKSLHALYLKNL+P+S YLSNHFILLYSKCGCL+AAHHAFN T Sbjct: 1 TFRQVLKTCVGRRDLVTGKSLHALYLKNLVPFSAYLSNHFILLYSKCGCLSAAHHAFNQT 60 Query: 120 HDANVFSFNVLLAAHVKHSCVATARQLFDLIPQPDLVSYN 1 ANVFSFNVLLAA+ + +A+ARQLFD IPQPDLVSYN Sbjct: 61 QHANVFSFNVLLAAYARQLRIASARQLFDQIPQPDLVSYN 100 >ref|XP_010999919.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49710 [Populus euphratica] Length = 720 Score = 162 bits (409), Expect = 1e-37 Identities = 75/105 (71%), Positives = 87/105 (82%) Frame = -2 Query: 315 SWTLQTFRQLLKTCIAQRNLLTGKSLHALYLKNLIPYSTYLSNHFILLYSKCGCLAAAHH 136 SWTLQ+FRQ+LK+CIA ++LLTGKSLH +YLK+LIP STYLSNHFILLYSKC L AHH Sbjct: 5 SWTLQSFRQILKSCIANKDLLTGKSLHTIYLKSLIPSSTYLSNHFILLYSKCNLLTTAHH 64 Query: 135 AFNHTHDANVFSFNVLLAAHVKHSCVATARQLFDLIPQPDLVSYN 1 AFN TH+ NVFSFN L+AA+ K S + A LFD IPQPDLVS+N Sbjct: 65 AFNQTHEPNVFSFNALIAAYAKESLIHVAHHLFDQIPQPDLVSFN 109 >ref|XP_002320672.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550323097|gb|EEE98987.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 720 Score = 162 bits (409), Expect = 1e-37 Identities = 75/105 (71%), Positives = 87/105 (82%) Frame = -2 Query: 315 SWTLQTFRQLLKTCIAQRNLLTGKSLHALYLKNLIPYSTYLSNHFILLYSKCGCLAAAHH 136 SWTLQ+FRQ+LK+CIA ++LLTGKSLH +YLK+LIP STYLSNHFILLYSKC L AHH Sbjct: 5 SWTLQSFRQILKSCIANKDLLTGKSLHTIYLKSLIPSSTYLSNHFILLYSKCNLLTTAHH 64 Query: 135 AFNHTHDANVFSFNVLLAAHVKHSCVATARQLFDLIPQPDLVSYN 1 AFN TH+ NVFSFN L+AA+ K S + A LFD IPQPDLVS+N Sbjct: 65 AFNQTHEPNVFSFNALIAAYAKESLIHVAHHLFDQIPQPDLVSFN 109 >ref|XP_007047622.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] gi|508699883|gb|EOX91779.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 718 Score = 160 bits (405), Expect = 3e-37 Identities = 77/106 (72%), Positives = 87/106 (82%) Frame = -2 Query: 318 ISWTLQTFRQLLKTCIAQRNLLTGKSLHALYLKNLIPYSTYLSNHFILLYSKCGCLAAAH 139 +SWT+QTFR LLKTCI R+LLTGKSLHALY+K+LIP STYLSNHFILLYSKCG L AAH Sbjct: 4 MSWTIQTFRNLLKTCITHRDLLTGKSLHALYIKSLIPSSTYLSNHFILLYSKCGHLTAAH 63 Query: 138 HAFNHTHDANVFSFNVLLAAHVKHSCVATARQLFDLIPQPDLVSYN 1 +AF+ T D N FSFN ++AA+ K S A QLFD IPQPDLVSYN Sbjct: 64 NAFHQTQDPNTFSFNAIIAAYAKESFPFVAHQLFDQIPQPDLVSYN 109 >ref|XP_002530602.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223529850|gb|EEF31782.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 567 Score = 152 bits (385), Expect = 7e-35 Identities = 74/106 (69%), Positives = 83/106 (78%) Frame = -2 Query: 318 ISWTLQTFRQLLKTCIAQRNLLTGKSLHALYLKNLIPYSTYLSNHFILLYSKCGCLAAAH 139 ISWTLQTFR LLK CIA ++LL GKSL+ LYLK+L+P STYLSNHFI+LYSKC L AH Sbjct: 4 ISWTLQTFRHLLKECIANKDLLIGKSLYTLYLKSLLPPSTYLSNHFIILYSKCNRLTLAH 63 Query: 138 HAFNHTHDANVFSFNVLLAAHVKHSCVATARQLFDLIPQPDLVSYN 1 HAFN H+ NVFSFNVLL A+ K S AR LFD IPQPD +SYN Sbjct: 64 HAFNQNHEPNVFSFNVLLDAYAKKSLTHIARGLFDQIPQPDAISYN 109 >ref|XP_012437174.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49710 [Gossypium raimondii] gi|763781700|gb|KJB48771.1| hypothetical protein B456_008G086300 [Gossypium raimondii] Length = 718 Score = 150 bits (380), Expect = 3e-34 Identities = 71/106 (66%), Positives = 82/106 (77%) Frame = -2 Query: 318 ISWTLQTFRQLLKTCIAQRNLLTGKSLHALYLKNLIPYSTYLSNHFILLYSKCGCLAAAH 139 I WT+Q FR LLKTCI+ RN+LTGKSLH LY+K+LIP STYLSNHFILLYS+CG LA AH Sbjct: 4 IPWTIQNFRNLLKTCISHRNILTGKSLHTLYIKSLIPSSTYLSNHFILLYSRCGLLATAH 63 Query: 138 HAFNHTHDANVFSFNVLLAAHVKHSCVATARQLFDLIPQPDLVSYN 1 +AF T N FSFN ++AA+ K S + A LFD IP PDLVSYN Sbjct: 64 NAFFQTQHPNTFSFNAIIAAYAKESLPSVAHNLFDQIPHPDLVSYN 109 >ref|XP_008442084.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49710 [Cucumis melo] Length = 720 Score = 149 bits (375), Expect = 1e-33 Identities = 70/102 (68%), Positives = 85/102 (83%) Frame = -2 Query: 306 LQTFRQLLKTCIAQRNLLTGKSLHALYLKNLIPYSTYLSNHFILLYSKCGCLAAAHHAFN 127 LQ+FR++LKTCIAQR+L TGKSLHALY+K+ +P STYLSNHF+LLYSKC L+AA F+ Sbjct: 8 LQSFRKILKTCIAQRDLRTGKSLHALYIKSFVPTSTYLSNHFLLLYSKCRRLSAARRVFD 67 Query: 126 HTHDANVFSFNVLLAAHVKHSCVATARQLFDLIPQPDLVSYN 1 HTHD NVFSFN L++A+ K S V AR+LFD +PQPD VSYN Sbjct: 68 HTHDCNVFSFNTLISAYAKESYVEVARKLFDEMPQPDSVSYN 109 >ref|XP_012079465.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49710 [Jatropha curcas] gi|643722243|gb|KDP32122.1| hypothetical protein JCGZ_12583 [Jatropha curcas] Length = 720 Score = 148 bits (374), Expect = 1e-33 Identities = 69/106 (65%), Positives = 80/106 (75%) Frame = -2 Query: 318 ISWTLQTFRQLLKTCIAQRNLLTGKSLHALYLKNLIPYSTYLSNHFILLYSKCGCLAAAH 139 +SWT Q FRQLLK CI R+L TGK+LH LY+K+ +P STYLSNHFI+LYSKC L AH Sbjct: 4 VSWTYQAFRQLLKACITNRDLPTGKALHTLYIKSTVPSSTYLSNHFIILYSKCNRLTTAH 63 Query: 138 HAFNHTHDANVFSFNVLLAAHVKHSCVATARQLFDLIPQPDLVSYN 1 +AF H H+ N+FSFNVLL A+ K S A LFD IPQPDLVSYN Sbjct: 64 NAFKHIHEPNIFSFNVLLDAYAKESLTDIAHHLFDQIPQPDLVSYN 109 >ref|XP_008342220.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49710 [Malus domestica] Length = 719 Score = 147 bits (372), Expect = 2e-33 Identities = 73/105 (69%), Positives = 83/105 (79%) Frame = -2 Query: 315 SWTLQTFRQLLKTCIAQRNLLTGKSLHALYLKNLIPYSTYLSNHFILLYSKCGCLAAAHH 136 S LQ+FR LLKTCIA R+L TGK+LHALY+K+L+P STYLSNHFILLYSKCG L+AA Sbjct: 5 SCNLQSFRHLLKTCIADRDLFTGKALHALYIKSLLPPSTYLSNHFILLYSKCGRLSAARS 64 Query: 135 AFNHTHDANVFSFNVLLAAHVKHSCVATARQLFDLIPQPDLVSYN 1 AFNHT D NVFSFN ++ A+ K S A QLFD IP PDLVSYN Sbjct: 65 AFNHTQDPNVFSFNAIINAYAKESHTHIAHQLFDKIPIPDLVSYN 109 >emb|CBI29560.3| unnamed protein product [Vitis vinifera] Length = 640 Score = 147 bits (370), Expect = 4e-33 Identities = 73/106 (68%), Positives = 82/106 (77%) Frame = -2 Query: 318 ISWTLQTFRQLLKTCIAQRNLLTGKSLHALYLKNLIPYSTYLSNHFILLYSKCGCLAAAH 139 ISWTLQ FR LLKTCIA+R+L TGKSLH+LY+K+ IP STY SNHFILLYSKCG LA A Sbjct: 4 ISWTLQRFRHLLKTCIAERDLSTGKSLHSLYIKSFIPPSTYFSNHFILLYSKCGRLAWAR 63 Query: 138 HAFNHTHDANVFSFNVLLAAHVKHSCVATARQLFDLIPQPDLVSYN 1 AF D NVFSFN ++AA+ K S A QLFD IP+PDLVSYN Sbjct: 64 KAFQDISDPNVFSFNAIIAAYAKESRPLIAHQLFDQIPEPDLVSYN 109 >ref|XP_002268807.2| PREDICTED: pentatricopeptide repeat-containing protein At3g49710 [Vitis vinifera] Length = 719 Score = 147 bits (370), Expect = 4e-33 Identities = 73/106 (68%), Positives = 82/106 (77%) Frame = -2 Query: 318 ISWTLQTFRQLLKTCIAQRNLLTGKSLHALYLKNLIPYSTYLSNHFILLYSKCGCLAAAH 139 ISWTLQ FR LLKTCIA+R+L TGKSLH+LY+K+ IP STY SNHFILLYSKCG LA A Sbjct: 4 ISWTLQRFRHLLKTCIAERDLSTGKSLHSLYIKSFIPPSTYFSNHFILLYSKCGRLAWAR 63 Query: 138 HAFNHTHDANVFSFNVLLAAHVKHSCVATARQLFDLIPQPDLVSYN 1 AF D NVFSFN ++AA+ K S A QLFD IP+PDLVSYN Sbjct: 64 KAFQDISDPNVFSFNAIIAAYAKESRPLIAHQLFDQIPEPDLVSYN 109 >emb|CAN74731.1| hypothetical protein VITISV_037837 [Vitis vinifera] Length = 719 Score = 147 bits (370), Expect = 4e-33 Identities = 73/106 (68%), Positives = 82/106 (77%) Frame = -2 Query: 318 ISWTLQTFRQLLKTCIAQRNLLTGKSLHALYLKNLIPYSTYLSNHFILLYSKCGCLAAAH 139 ISWTLQ FR LLKTCIA+R+L TGKSLH+LY+K+ IP STY SNHFILLYSKCG LA A Sbjct: 4 ISWTLQRFRHLLKTCIAERDLSTGKSLHSLYIKSFIPPSTYFSNHFILLYSKCGRLAWAR 63 Query: 138 HAFNHTHDANVFSFNVLLAAHVKHSCVATARQLFDLIPQPDLVSYN 1 AF D NVFSFN ++AA+ K S A QLFD IP+PDLVSYN Sbjct: 64 KAFQDISDPNVFSFNAIIAAYAKESRPLIAHQLFDQIPEPDLVSYN 109 >ref|XP_010647376.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49710-like [Vitis vinifera] Length = 355 Score = 145 bits (366), Expect = 1e-32 Identities = 73/106 (68%), Positives = 81/106 (76%) Frame = -2 Query: 318 ISWTLQTFRQLLKTCIAQRNLLTGKSLHALYLKNLIPYSTYLSNHFILLYSKCGCLAAAH 139 ISWTLQ FR LLKTCIA+R+L TGKSLH+LY+K+ IP STY SNHFILLYSKCG LA A Sbjct: 4 ISWTLQRFRHLLKTCIAERDLSTGKSLHSLYIKSFIPPSTYFSNHFILLYSKCGRLAWAR 63 Query: 138 HAFNHTHDANVFSFNVLLAAHVKHSCVATARQLFDLIPQPDLVSYN 1 AF D NVFSFN ++AA+ K S A QLFD IP PDLVSYN Sbjct: 64 KAFEDISDPNVFSFNAIIAAYAKESPPLIAHQLFDQIPVPDLVSYN 109 >emb|CDP02643.1| unnamed protein product [Coffea canephora] Length = 711 Score = 145 bits (366), Expect = 1e-32 Identities = 74/106 (69%), Positives = 85/106 (80%), Gaps = 1/106 (0%) Frame = -2 Query: 315 SWTL-QTFRQLLKTCIAQRNLLTGKSLHALYLKNLIPYSTYLSNHFILLYSKCGCLAAAH 139 SW+L Q FRQLLKTCI QR+LLTGKSLHAL++K+LIP STYLSNHFI LYSKCG L+ A Sbjct: 5 SWSLVQQFRQLLKTCIIQRDLLTGKSLHALFIKSLIPPSTYLSNHFITLYSKCGLLSDAR 64 Query: 138 HAFNHTHDANVFSFNVLLAAHVKHSCVATARQLFDLIPQPDLVSYN 1 AF+ T + NVFSFN ++AA+ K S A QLFD IPQPDLVSYN Sbjct: 65 KAFDTTANPNVFSFNAIIAAYAKESLAHFAHQLFDQIPQPDLVSYN 110 >emb|CBI18837.3| unnamed protein product [Vitis vinifera] Length = 1589 Score = 145 bits (366), Expect = 1e-32 Identities = 73/106 (68%), Positives = 81/106 (76%) Frame = -2 Query: 318 ISWTLQTFRQLLKTCIAQRNLLTGKSLHALYLKNLIPYSTYLSNHFILLYSKCGCLAAAH 139 ISWTLQ FR LLKTCIA+R+L TGKSLH+LY+K+ IP STY SNHFILLYSKCG LA A Sbjct: 4 ISWTLQRFRHLLKTCIAERDLSTGKSLHSLYIKSFIPPSTYFSNHFILLYSKCGRLAWAR 63 Query: 138 HAFNHTHDANVFSFNVLLAAHVKHSCVATARQLFDLIPQPDLVSYN 1 AF D NVFSFN ++AA+ K S A QLFD IP PDLVSYN Sbjct: 64 KAFEDISDPNVFSFNAIIAAYAKESPPLIAHQLFDQIPVPDLVSYN 109 >ref|XP_010099413.1| hypothetical protein L484_007776 [Morus notabilis] gi|587889591|gb|EXB78258.1| hypothetical protein L484_007776 [Morus notabilis] Length = 719 Score = 145 bits (365), Expect = 1e-32 Identities = 70/106 (66%), Positives = 84/106 (79%) Frame = -2 Query: 318 ISWTLQTFRQLLKTCIAQRNLLTGKSLHALYLKNLIPYSTYLSNHFILLYSKCGCLAAAH 139 IS TLQ FR LLKTCIA R+L TGKSLH LY+K+L+ +STYLSNHFI+LYSKCG L+ A Sbjct: 4 ISRTLQNFRHLLKTCIADRDLFTGKSLHTLYIKSLVSHSTYLSNHFIVLYSKCGRLSLAR 63 Query: 138 HAFNHTHDANVFSFNVLLAAHVKHSCVATARQLFDLIPQPDLVSYN 1 AFN + NVF+FN ++AA+ K S + ARQLFD IP+PDLVSYN Sbjct: 64 RAFNGIPEPNVFTFNAIIAAYAKESLIHVARQLFDQIPRPDLVSYN 109 >ref|XP_004146400.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49710 [Cucumis sativus] gi|700199669|gb|KGN54827.1| hypothetical protein Csa_4G508540 [Cucumis sativus] Length = 720 Score = 145 bits (365), Expect = 1e-32 Identities = 69/102 (67%), Positives = 80/102 (78%) Frame = -2 Query: 306 LQTFRQLLKTCIAQRNLLTGKSLHALYLKNLIPYSTYLSNHFILLYSKCGCLAAAHHAFN 127 L FRQ LKTCIA R+L TGKSLHALY+K+ +P STYLSNHF+LLYSKC L+AA F+ Sbjct: 8 LHNFRQFLKTCIAHRDLRTGKSLHALYIKSFVPTSTYLSNHFLLLYSKCRRLSAARRVFD 67 Query: 126 HTHDANVFSFNVLLAAHVKHSCVATARQLFDLIPQPDLVSYN 1 HTHD NVFSFN L++A+ K S V A QLFD +PQPD VSYN Sbjct: 68 HTHDCNVFSFNTLISAYAKESYVEVAHQLFDEMPQPDSVSYN 109 >ref|XP_010041244.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49710-like isoform X1 [Eucalyptus grandis] Length = 728 Score = 144 bits (364), Expect = 2e-32 Identities = 71/106 (66%), Positives = 84/106 (79%) Frame = -2 Query: 318 ISWTLQTFRQLLKTCIAQRNLLTGKSLHALYLKNLIPYSTYLSNHFILLYSKCGCLAAAH 139 +SW L +FR LLK CIA+R+ LTGKSLHALY+K+L+P STYLSNHFILLYSKC L AA Sbjct: 4 LSWNLHSFRHLLKHCIAERDFLTGKSLHALYIKSLVPPSTYLSNHFILLYSKCRRLLAAR 63 Query: 138 HAFNHTHDANVFSFNVLLAAHVKHSCVATARQLFDLIPQPDLVSYN 1 AF+ T + NVFSFN ++AA+ K S + ARQLFD IP PDLVSYN Sbjct: 64 RAFDLTPNPNVFSFNAIVAAYAKESQMMVARQLFDRIPAPDLVSYN 109