BLASTX nr result
ID: Zanthoxylum22_contig00038593
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00038593 (398 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO40737.1| hypothetical protein CISIN_1g046597mg [Citrus sin... 67 4e-09 ref|XP_006478019.1| PREDICTED: BTB/POZ domain-containing protein... 67 4e-09 ref|XP_006441038.1| hypothetical protein CICLE_v10018677mg [Citr... 67 4e-09 >gb|KDO40737.1| hypothetical protein CISIN_1g046597mg [Citrus sinensis] Length = 673 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +2 Query: 2 YCTLRDSGDLEELDEFLVDMVRAASVRHSQGGG 100 YC LRDSGDLE+LDEFLVDMVRAASVRHSQGGG Sbjct: 641 YCNLRDSGDLEDLDEFLVDMVRAASVRHSQGGG 673 >ref|XP_006478019.1| PREDICTED: BTB/POZ domain-containing protein At1g04390-like isoform X1 [Citrus sinensis] Length = 1007 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +2 Query: 2 YCTLRDSGDLEELDEFLVDMVRAASVRHSQGGG 100 YC LRDSGDLE+LDEFLVDMVRAASVRHSQGGG Sbjct: 975 YCNLRDSGDLEDLDEFLVDMVRAASVRHSQGGG 1007 >ref|XP_006441038.1| hypothetical protein CICLE_v10018677mg [Citrus clementina] gi|557543300|gb|ESR54278.1| hypothetical protein CICLE_v10018677mg [Citrus clementina] Length = 1004 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +2 Query: 2 YCTLRDSGDLEELDEFLVDMVRAASVRHSQGGG 100 YC LRDSGDLE+LDEFLVDMVRAASVRHSQGGG Sbjct: 972 YCNLRDSGDLEDLDEFLVDMVRAASVRHSQGGG 1004