BLASTX nr result
ID: Zanthoxylum22_contig00038456
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zanthoxylum22_contig00038456 (327 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESZ90221.1| hypothetical protein SBOR_9391 [Sclerotinia borea... 56 9e-06 >gb|ESZ90221.1| hypothetical protein SBOR_9391 [Sclerotinia borealis F-4157] Length = 213 Score = 56.2 bits (134), Expect = 9e-06 Identities = 35/77 (45%), Positives = 46/77 (59%), Gaps = 5/77 (6%) Frame = -1 Query: 237 TAFAASALLFTGA---LAQ--KQSKPFYLELKSGNSSLDGHVLDAGHEGAAIEGLLLGPK 73 T+F ++LL A +AQ QS PF L L+S + +LDG L HEGAAIEGL LGP Sbjct: 3 TSFVTASLLVAAATQVMAQYTNQSAPFVLVLESHDYALDGLTLSPCHEGAAIEGLCLGP- 61 Query: 72 AAAVPKKTANYYTFNFN 22 ++ K + T+NFN Sbjct: 62 --SIESKNTTFSTYNFN 76